DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9662 and Ostc

DIOPT Version :9

Sequence 1:NP_001259997.1 Gene:CG9662 / 33554 FlyBaseID:FBgn0031529 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_079785.1 Gene:Ostc / 66357 MGIID:1913607 Length:149 Species:Mus musculus


Alignment Length:147 Identity:92/147 - (62%)
Similarity:119/147 - (80%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IETLYNLPFHILVPPNIKVRRFS-IPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLGATVDE 65
            :||||.:||.:|..||:|:::.. :.|||.|.|:::::.||||:||||||||||||||:|:..||
Mouse     1 METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDE 65

  Fly    66 HGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLLTAMGFIFILV 130
            |||.|||||:.|||||||||||||||||||:|||||||:|:::.|....|||.||..:||:.:|:
Mouse    66 HGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLL 130

  Fly   131 SFFTTWLFMRMKLPSYL 147
            |||...:|||||||.||
Mouse   131 SFFMARVFMRMKLPGYL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9662NP_001259997.1 OST3_OST6 <38..146 CDD:398430 75/107 (70%)
OstcNP_079785.1 OST3_OST6 <17..146 CDD:398430 81/128 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837677
Domainoid 1 1.000 173 1.000 Domainoid score I3682
eggNOG 1 0.900 - - E1_KOG3356
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10933
Inparanoid 1 1.050 194 1.000 Inparanoid score I3831
Isobase 1 0.950 - 0 Normalized mean entropy S4730
OMA 1 1.010 - - QHG59793
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005803
OrthoInspector 1 1.000 - - oto92731
orthoMCL 1 0.900 - - OOG6_105838
Panther 1 1.100 - - LDO PTHR13160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4708
SonicParanoid 1 1.000 - - X4193
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.