DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9662 and OSTC

DIOPT Version :9

Sequence 1:NP_001259997.1 Gene:CG9662 / 33554 FlyBaseID:FBgn0031529 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001254747.1 Gene:OSTC / 58505 HGNCID:24448 Length:171 Species:Homo sapiens


Alignment Length:147 Identity:91/147 - (61%)
Similarity:118/147 - (80%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IETLYNLPFHILVPPNIKVRRFS-IPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLGATVDE 65
            :||||.:||.:|..||:|:::.. :.|||.|.|:::::.||||:||||||||||||||:|:..||
Human     1 METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDE 65

  Fly    66 HGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLLTAMGFIFILV 130
            |||.|||||:.|||||||||||||||||||:|||||||:|:::.|....|||.||..:||:.:|:
Human    66 HGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLL 130

  Fly   131 SFFTTWLFMRMKLPSYL 147
            |||...:|||||||..|
Human   131 SFFMARVFMRMKLPRSL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9662NP_001259997.1 OST3_OST6 <38..146 CDD:398430 75/107 (70%)
OSTCNP_001254747.1 OST3_OST6 <34..133 CDD:282594 66/98 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147599
Domainoid 1 1.000 173 1.000 Domainoid score I3702
eggNOG 1 0.900 - - E1_KOG3356
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10933
Inparanoid 1 1.050 193 1.000 Inparanoid score I3850
Isobase 1 0.950 - 0 Normalized mean entropy S4730
OMA 1 1.010 - - QHG59793
OrthoDB 1 1.010 - - D1575260at2759
OrthoFinder 1 1.000 - - FOG0005803
OrthoInspector 1 1.000 - - oto89167
orthoMCL 1 0.900 - - OOG6_105838
Panther 1 1.100 - - LDO PTHR13160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4708
SonicParanoid 1 1.000 - - X4193
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1817.750

Return to query results.
Submit another query.