Sequence 1: | NP_001259996.1 | Gene: | CG15412 / 33553 | FlyBaseID: | FBgn0031528 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 226 | Identity: | 45/226 - (19%) |
---|---|---|---|
Similarity: | 76/226 - (33%) | Gaps: | 88/226 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 HMHYMYDIVRKCKQLVKLYVPYIANDRL---LEEIGNC--CTRLQILDISGETDITEIGIDLLAK 190
Fly 191 GVCSQSLTVVDVGMPGEENICYSDIAL-ILEHCPQVE--TLSTYSFVGASLKFIHDNVDDRFKCR 252
Fly 253 LKYIHDTGTDEATLQVIMQTCPRLETLYLDSPKTGSLRALSTRNLRKLKIYKFVVAELLPLLERP 317
Fly 318 IGRNLR--HLTMIKGLGNLELGKLARLCPSL 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15412 | NP_001259996.1 | AMN1 | <142..>228 | CDD:187754 | 17/93 (18%) |
leucine-rich repeat | 145..168 | CDD:275381 | 5/27 (19%) | ||
leucine-rich repeat | 169..196 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 197..224 | CDD:275381 | 4/27 (15%) | ||
leucine-rich repeat | 225..252 | CDD:275381 | 4/28 (14%) | ||
leucine-rich repeat | 253..275 | CDD:275381 | 3/21 (14%) | ||
leucine-rich repeat | 369..393 | CDD:275381 | |||
leucine-rich repeat | 394..416 | CDD:275381 | |||
Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | |
LRR 1 | 15..40 | ||||
LRR 2 | 43..72 | 6/37 (16%) | |||
AMN1 | 45..>200 | CDD:187754 | 45/226 (20%) | ||
LRR 3 | 98..123 | 7/36 (19%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 7/51 (14%) | ||
LRR 4 | 124..149 | 10/51 (20%) | |||
leucine-rich repeat | 142..167 | CDD:275381 | 9/44 (20%) | ||
LRR 5 | 150..175 | 8/44 (18%) | |||
leucine-rich repeat | 168..193 | CDD:275381 | 5/24 (21%) | ||
LRR 6 | 176..201 | 5/19 (26%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16134 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |