DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15412 and Fbxl22

DIOPT Version :9

Sequence 1:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_780415.1 Gene:Fbxl22 / 74165 MGIID:1921415 Length:236 Species:Mus musculus


Alignment Length:226 Identity:45/226 - (19%)
Similarity:76/226 - (33%) Gaps:88/226 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 HMHYMYDIVRKCKQLVKLYVPYIANDRL---LEEIGNC--CTRLQILDISGETDITEIGIDLLAK 190
            |.|.:.::.:.             |.||   |..:..|  .:|:|:..|.....      ..|.:
Mouse    47 HFHSLAELKKD-------------NFRLSPALRSLSICWHSSRVQVCSIEDWLK------SALQR 92

  Fly   191 GVCSQSLTVVDVGMPGEENICYSDIAL-ILEHCPQVE--TLSTYSFVGASLKFIHDNVDDRFKCR 252
            .:|||..::|            :|..| :...||.:.  |||....|                  
Mouse    93 SICSQHESLV------------NDFLLQVCNRCPNLTSVTLSGCGHV------------------ 127

  Fly   253 LKYIHDTGTDEATLQVIMQTCPRLETLYLDSPKTGSLRALSTRNLRKLKIYKFVVAELLPLLERP 317
                    ||:...:::: :||||.||.|::....:.|.|:.           |.|.        
Mouse   128 --------TDDCLARLLL-SCPRLRTLRLENCARVTNRTLAA-----------VAAH-------- 164

  Fly   318 IGRNLR--HLTMIKGLGNLELGKLARLCPSL 346
             ||.|:  |:...:.:....|.:|...||:|
Mouse   165 -GRALQTLHVDFCRNVSAAGLLRLRAACPNL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 17/93 (18%)
leucine-rich repeat 145..168 CDD:275381 5/27 (19%)
leucine-rich repeat 169..196 CDD:275381 5/26 (19%)
leucine-rich repeat 197..224 CDD:275381 4/27 (15%)
leucine-rich repeat 225..252 CDD:275381 4/28 (14%)
leucine-rich repeat 253..275 CDD:275381 3/21 (14%)
leucine-rich repeat 369..393 CDD:275381
leucine-rich repeat 394..416 CDD:275381
Fbxl22NP_780415.1 F-box-like 3..43 CDD:403981
LRR 1 15..40
LRR 2 43..72 6/37 (16%)
AMN1 45..>200 CDD:187754 45/226 (20%)
LRR 3 98..123 7/36 (19%)
leucine-rich repeat 116..141 CDD:275381 7/51 (14%)
LRR 4 124..149 10/51 (20%)
leucine-rich repeat 142..167 CDD:275381 9/44 (20%)
LRR 5 150..175 8/44 (18%)
leucine-rich repeat 168..193 CDD:275381 5/24 (21%)
LRR 6 176..201 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.