DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15412 and Fbxl17

DIOPT Version :9

Sequence 1:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_056609.1 Gene:Fbxl17 / 50758 MGIID:1354704 Length:701 Species:Mus musculus


Alignment Length:363 Identity:76/363 - (20%)
Similarity:144/363 - (39%) Gaps:98/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LVKLYVPYIANDRLLEEIGNC------CTRLQI---LDISGETDITEIGIDLLAKGVCSQSLTVV 200
            |:|::.....|:|.|.....|      |...|.   ||:|....:|:   :||.| :.|:|..::
Mouse   329 LLKIFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVTD---ELLEK-IASRSQNII 389

  Fly   201 DVGMPGEENICYSDIALILEHCP--------QVETLSTYSFVGAS-----LKFIHDNVDDRF--- 249
            ::.:....::..|.:.::...||        :.:.||..|.:..:     |:.:|....|:.   
Mouse   390 EINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDE 454

  Fly   250 -------KCR-LKYIHDTG-----TDEATLQVIMQTCPRLETLYLDSPK---TGSLRALSTRNLR 298
                   :|| ||.|| .|     :||..: ||.::|.:|:.:|:...|   ..|::|.: .:..
Mouse   455 GLKQLGSRCRELKDIH-FGQCYKISDEGMI-VIAKSCLKLQRIYMQENKLVTDQSVKAFA-EHCP 516

  Fly   299 KLKIYKFVVAELLPLLERPIGRNLRHLTMIKGLGNLELGKLARL-----------CPSLIDLD-C 351
            :|:...|:...:       ..:.:.|||.::.|.:|:|..:..|           |.:|..|: |
Mouse   517 ELQYVGFMGCSV-------TSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLC 574

  Fly   352 --YMIDSLSYGAGHAKFQQLEGLEILSSAILTSSLKAFLCNSTDLKRLAVDTVEFTDDDIMSMFM 414
              ::|:.........:.|.|:.|.::|            |..||...:|:.....|.:.:     
Mouse   575 LNWIINDRCVEVIAKEGQNLKELYLVS------------CKITDYALIAIGRYSVTIETV----- 622

  Fly   415 QHDFKVLEDV-WFTLAPELTVQSVELLMDSCPELQSVG 451
                    || |   ..|:|.|...|:..|...|:.:|
Mouse   623 --------DVGW---CKEITDQGATLIAQSSKSLRYLG 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 20/99 (20%)
leucine-rich repeat 145..168 CDD:275381 7/28 (25%)
leucine-rich repeat 169..196 CDD:275381 9/29 (31%)
leucine-rich repeat 197..224 CDD:275381 3/34 (9%)
leucine-rich repeat 225..252 CDD:275381 6/41 (15%)
leucine-rich repeat 253..275 CDD:275381 10/26 (38%)
leucine-rich repeat 369..393 CDD:275381 4/23 (17%)
leucine-rich repeat 394..416 CDD:275381 2/21 (10%)
Fbxl17NP_056609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..321
F-box-like 321..368 CDD:289689 10/38 (26%)
leucine-rich repeat 362..387 CDD:275381 9/28 (32%)
leucine-rich repeat 388..413 CDD:275381 2/24 (8%)
AMN1 411..573 CDD:187754 37/171 (22%)
leucine-rich repeat 414..439 CDD:275381 3/24 (13%)
leucine-rich repeat 440..465 CDD:275381 4/24 (17%)
leucine-rich repeat 466..491 CDD:275381 10/26 (38%)
leucine-rich repeat 492..517 CDD:275381 5/25 (20%)
leucine-rich repeat 545..567 CDD:275381 4/21 (19%)
leucine-rich repeat 568..593 CDD:275381 4/24 (17%)
leucine-rich repeat 594..618 CDD:275381 7/35 (20%)
leucine-rich repeat 619..644 CDD:275381 8/40 (20%)
leucine-rich repeat 645..670 CDD:275381 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.