DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15412 and FBXL6

DIOPT Version :10

Sequence 1:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_036294.2 Gene:FBXL6 / 26233 HGNCID:13603 Length:539 Species:Homo sapiens


Alignment Length:375 Identity:87/375 - (23%)
Similarity:134/375 - (35%) Gaps:120/375 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LLEEIGNCCTRLQILDISGETDITEIGIDLLAKGVCSQSLTVVDVGMPGEENICYSDIALILEHC 222
            :|:.:|.||.||..|.:||...:|...:.:|||..|...                   :|.|:| 
Human   211 VLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLH-------------------SLDLQH- 255

  Fly   223 PQVETLSTYSFV---GASLKFIHDNVDDRFKCRLKYIHDTGTDEATLQVIM-QTCPRLETLYLDS 283
            ..||:.:..||:   |:.::          |..|.|...|   .|.|..:: ..||:|:.|.:  
Human   256 SMVESTAVVSFLEEAGSRMR----------KLWLTYSSQT---TAILGALLGSCCPQLQVLEV-- 305

  Fly   284 PKTGSLR-----ALSTRNLRK----LKIYKFVVAELLPLLERPIGR---------NLRHLTMIKG 330
             .||..|     .|....|:|    |::.:.:....||   :|.||         :|..|.:...
Human   306 -STGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLP---KPPGRGVAPGPGFPSLEELCLASS 366

  Fly   331 ----LGNLELGKL---------------ARLCPS-LIDLDCYMIDSLS---YGAGHAKFQQLEGL 372
                :.|..||:|               ||:.|: |.||.|..::.|.   ||.........|| 
Human   367 TCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTLAKEG- 430

  Fly   373 EILSSAILTSSLKAFLCNSTDLKRLAVDTVEFTDDDIMSMFMQHDFKVLEDVWFTLAPELTVQSV 437
                |..||..    .|::  |:.|.:....|::.|:..               .||..|:... 
Human   431 ----SPFLTQK----WCHT--LRELDLSGQGFSEKDLEQ---------------ALAAFLSTPG- 469

  Fly   438 ELLMDSCPELQSVGQLNGWSLTPDDLALI----RGLLKSGNSSIVLTPNG 483
                .|.|.|.|: .|.|..:||..::.:    .|||.....|....|.|
Human   470 ----GSHPALCSL-NLRGTRVTPSTVSSVISGCPGLLYLNLESCRCLPRG 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 19/69 (28%)
leucine-rich repeat 145..168 CDD:275381 4/9 (44%)
leucine-rich repeat 169..196 CDD:275381 9/26 (35%)
leucine-rich repeat 197..224 CDD:275381 3/26 (12%)
leucine-rich repeat 225..252 CDD:275381 6/29 (21%)
leucine-rich repeat 253..275 CDD:275381 6/22 (27%)
leucine-rich repeat 369..393 CDD:275381 6/23 (26%)
leucine-rich repeat 394..416 CDD:275381 4/21 (19%)
FBXL6NP_036294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..111
F-box_FBXL6 112..158 CDD:438891
LRR 1 177..203
AMN1 185..398 CDD:187754 52/225 (23%)
leucine-rich repeat 196..221 CDD:275381 4/9 (44%)
LRR 2 204..229 7/17 (41%)
leucine-rich repeat 222..247 CDD:275381 8/24 (33%)
LRR 3 230..255 7/43 (16%)
leucine-rich repeat 248..299 CDD:275381 15/83 (18%)
LRR 4 281..307 8/31 (26%)
leucine-rich repeat 300..329 CDD:275381 8/31 (26%)
LRR 5 312..337 4/24 (17%)
leucine-rich repeat 330..357 CDD:275381 6/29 (21%)
LRR 6 341..365 7/26 (27%)
AMN1 <357..508 CDD:187754 40/182 (22%)
leucine-rich repeat 358..385 CDD:275381 6/26 (23%)
LRR 7 368..393 4/24 (17%)
leucine-rich repeat 386..409 CDD:275381 7/22 (32%)
LRR 8 394..419 8/24 (33%)
LRR 9 423..449 8/36 (22%)
leucine-rich repeat 442..474 CDD:275381 8/51 (16%)
LRR 10 453..481 8/48 (17%)
leucine-rich repeat 475..499 CDD:275381 6/24 (25%)
LRR 11 482..507 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.