DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and AT3G59660

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:NP_191525.2 Gene:AT3G59660 / 825135 AraportID:AT3G59660 Length:594 Species:Arabidopsis thaliana


Alignment Length:115 Identity:39/115 - (33%)
Similarity:60/115 - (52%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 DVPNDERLIVDYSCALQRDILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVI 419
            |:..||.:...|||||:|..|..||:|||..::|||:|:||.:..|.:...|:..|.:.:.||:.
plant   236 DLLPDEVVEHSYSCALERSFLYHGRMYVSAWHICFHSNVFSKQMKVVVPLGDIDEIRRSQHALIN 300

  Fly   420 PNAISI----------------SSGKDKYFFATFTSRDKSFLMLFRVWQN 453
            | ||:|                ..|:.:|.||:|.:|:.:...|.|...|
plant   301 P-AITIILRMGAGGHGVPPLGTPDGRVRYKFASFWNRNHTLKALQRAVNN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 37/108 (34%)
DUF4782 751..897 CDD:292635
AT3G59660NP_191525.2 C2 83..179 CDD:175973
PH-GRAM_C2-GRAM 240..348 CDD:270039 37/108 (34%)
DUF4782 406..552 CDD:406424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.