DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and gramd2aa

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:XP_005166658.1 Gene:gramd2aa / 555179 ZFINID:ZDB-GENE-040724-9 Length:354 Species:Danio rerio


Alignment Length:310 Identity:90/310 - (29%)
Similarity:144/310 - (46%) Gaps:52/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 AAPGDSPSS-------RKSSTSSKGKASQAKLSTSSSGRDE-QDISQHRLSDLTQHELSLLRVDR 304
            ||..::||:       |....||:...::.:..:.|..:|: :|:..     ||.|:.|....|.
Zfish     7 AASSEAPSAEGPELQRRPHGYSSRTCRTRVRPKSMSDHQDQAEDVGL-----LTPHDQSEPSKDD 66

  Fly   305 EQ--QVTSSSSTSNEKPAKTSRLSERAKKKSWYNVIYPNYKSRAEDFKKLFKDVPNDERLIVDYS 367
            :.  ::......|.|...|..|.|..:|    ||..|          .|||:.||.:|.|:..||
Zfish    67 DMHFRIHLIDDLSYEDVKKCYRGSTVSK----YNAQY----------HKLFQSVPKEELLMKVYS 117

  Fly   368 CALQRDILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISISS-GKDK 431
            |||.||||:|||||:|:|::||:||:|..:..|:|....|..:.|.|||.::||.::|:: ...|
Zfish   118 CALLRDILLQGRLYISRNWLCFYANLFGKDIKVAIPVASVRLVKKHKTAGLVPNGLAITTDSSQK 182

  Fly   432 YFFATFTSRDKSFLMLFRVWQNTLMN--KQFSPQEIWQHVHTCYGDELGLTTDDEDYIDPTLNKT 494
            |.|.:..|||..:.:|.|:..:..:|  |..|.::..:..::...||.           |.....
Zfish   183 YVFVSLLSRDSVYDVLRRICTHLQVNGKKILSLKQYMEEPNSLSLDEF-----------PVPEVF 236

  Fly   495 NEPDFDFQTAIDDDSYSQRQSQQSNQSNQSNPLLPQSGNSSASSGGGVRA 544
            ..|| :|...:   .:.::.|..|..|:     ||....:||||...|.|
Zfish   237 PVPD-EFPPVL---KWRRKPSVVSVASS-----LPDLLGNSASSLSAVDA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 41/93 (44%)
DUF4782 751..897 CDD:292635
gramd2aaXP_005166658.1 PH-GRAM_GRAMDC 108..202 CDD:275406 41/93 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944155at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.