DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and Gramd2b

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:NP_001014033.1 Gene:Gramd2b / 307288 RGDID:1311016 Length:445 Species:Rattus norvegicus


Alignment Length:342 Identity:94/342 - (27%)
Similarity:159/342 - (46%) Gaps:77/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 TSPGSISSAGNTATLGAAPSINIVSSESTRDQTQQPQSVDPNGVAAP---GDSPSSRKSSTSSKG 265
            :||.|.:.|.:::|  .:||...:|||:            .|||...   ..||:::..::|.:.
  Rat    19 SSPKSSAGASHSST--DSPSSVFLSSEA------------ENGVEDRKRFSKSPTAQSPTSSVEA 69

  Fly   266 KASQAKLST---SSSGRDEQDISQHRLSDLTQHELSLLRVDREQQVTSSSSTSNEKPAKTSRLSE 327
            ::...|.|.   |.|..|..::    |||         :.|.:.:..:.|.|..:|.:.:|:   
  Rat    70 ESPDQKRSLGLWSKSSFDGSNL----LSD---------KNDCKTESKADSKTERKKSSSSSQ--- 118

  Fly   328 RAKKKSWYNVIYPNYKSRAEDFKKLFKDVPNDERLIVDYSCALQRDILVQGRLYVSQNYVCFHAN 392
                          ||:... |.|||.|||.:|.|...::||||::||.||:|:||:|::|||:.
  Rat   119 --------------YKANMH-FHKLFLDVPTEEPLRQSFTCALQKEILYQGKLFVSENWICFHSK 168

  Fly   393 IFSWETHVSIKWKDVTAITKEKTALVIPNAISISSGKDKYFFATFTSRDKSFLMLFRVWQNTLMN 457
            :|..:|.:||....||.|.|.||||::|||:.|::..|:|.|.:..|||.::.:|          
  Rat   169 VFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL---------- 223

  Fly   458 KQFSPQEIWQHV-HTCYGDELGLTTDDEDYIDPTLNKTNEPD---FDFQTAIDD-DSYSQRQSQQ 517
                 :.|..|: :|..|:....::.:..:      :.:.|.   .||.....| |...|::.|.
  Rat   224 -----KSICGHLENTSVGNSPNPSSAENSF------RADRPSSLRLDFNDEFSDLDGVVQQRRQD 277

  Fly   518 SNQSNQSNPLLPQSGNS 534
            ....:.|....|:|.||
  Rat   278 LEGYSSSGSQTPESENS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 40/92 (43%)
DUF4782 751..897 CDD:292635
Gramd2bNP_001014033.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 29/143 (20%)
PH-GRAM_GRAMDC 135..227 CDD:275406 40/106 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..331 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944155at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.