DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and Gramd2a

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:XP_006243259.1 Gene:Gramd2a / 300761 RGDID:1564007 Length:377 Species:Rattus norvegicus


Alignment Length:221 Identity:67/221 - (30%)
Similarity:104/221 - (47%) Gaps:26/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 GKASQAKLSTSSSGRDEQDISQHRLSDL-TQHELSLLRVDREQQVTSSSSTSNEKPAKTSR---- 324
            ||......:.:|..|...  |.|..:.| |.:.||..::..:.....:..:..|||.|...    
  Rat    41 GKMQPIDETVNSYSRSAP--SLHNWTSLATHYGLSNQQMHGKMVPLKNHVSCMEKPGKVQEPPDS 103

  Fly   325 --------LSERAKKKSWYNVIYPNYKSRAEDFKKLFKDVPNDERLIVDYSCALQRDILVQGRLY 381
                    ..|..||......:...|.   :.:.|||||:|.:|.::...|||||||:|:.||||
  Rat   104 SLHWSEGSKGEEIKKYGREGTLLNKYN---QQYHKLFKDIPLEEMVVKVCSCALQRDLLLHGRLY 165

  Fly   382 VSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISISSG-KDKYFFATFTSRDKSFL 445
            :|.|::||||::|..:..|.|....|..|.|.|.|.::||.::|::. ..||.|.:..|||..:.
  Rat   166 ISPNWLCFHASLFGKDIKVVIPVASVQLIKKHKMARLLPNGLAITTNTSQKYVFVSLLSRDSVYD 230

  Fly   446 MLFRVW-------QNTLMNKQFSPQE 464
            ||.||.       :.:|..::|..:|
  Rat   231 MLRRVCTHLQPSSKKSLSIRKFPEEE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 39/93 (42%)
DUF4782 751..897 CDD:292635
Gramd2aXP_006243259.1 PH-GRAM_GRAMDC 143..236 CDD:275406 39/92 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944155at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.