DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and GRAMD2A

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:NP_001012660.1 Gene:GRAMD2A / 196996 HGNCID:27287 Length:354 Species:Homo sapiens


Alignment Length:297 Identity:80/297 - (26%)
Similarity:128/297 - (43%) Gaps:57/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RVDREQQVTSSSSTSNEKPAKTSR------------LSERAKKKSWYNVIYPNYKSRAEDFKKLF 353
            ::.|:....:|..:..|||.:...            ..|..||.....:....|.   :.:.|||
Human    17 QMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKYN---QQYHKLF 78

  Fly   354 KDVPNDERLIVDYSCALQRDILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALV 418
            ||||.:|.::...|||||||.|:|||||:|.|::||||::|..:..|.|....|..|.|.|.|.:
Human    79 KDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKMARL 143

  Fly   419 IPNAISISSG-KDKYFFATFTSRDKSFLMLFRVW-------QNTLMNKQFS----------PQEI 465
            :||.::|::. ..||.|.:..|||..:.:|.||.       :.:|..::||          |:..
Human   144 LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMK 208

  Fly   466 WQHVHTCYGDELGLTTDDEDYIDPTLNKTNEPDFDFQTAID--DDSYSQRQSQQSNQSNQSNPLL 528
            |:.|  |.........|:...|.|             :::|  |..:..|:...|.:|...  :.
Human   209 WRKV--CPSSRSLSLPDNIPCIPP-------------SSVDSTDSFFPSRKPPMSEKSRAQ--VA 256

  Fly   529 PQSGNSSASSGGGVRASAPRKSKTKYFFNSSKSSANA 565
            .::|...|....|...:.|:|..     |.|.::.||
Human   257 SENGGRWAWPMPGWGPACPKKMP-----NCSPTAKNA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 39/93 (42%)
DUF4782 751..897 CDD:292635
GRAMD2ANP_001012660.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 5/28 (18%)
PH-GRAM_GRAMDC 84..177 CDD:275406 39/92 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944155at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.