DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GramD1B and gramd2b

DIOPT Version :9

Sequence 1:NP_995623.2 Gene:GramD1B / 33552 FlyBaseID:FBgn0085423 Length:1249 Species:Drosophila melanogaster
Sequence 2:XP_002663092.2 Gene:gramd2b / 100335008 -ID:- Length:367 Species:Danio rerio


Alignment Length:378 Identity:97/378 - (25%)
Similarity:165/378 - (43%) Gaps:73/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DSPSSRKSS--------TSSKGKASQAKLSTSSSGRDEQDISQHRLSDLTQHELSLLRVDREQQV 308
            |.|.||..:        ...:...|:..|...:...||.       ..:|:.: :.:.::.|.:|
Zfish    10 DDPQSRTDAFRPLCSVPPHQQNMESEVLLRHCAEDEDEG-------QKMTRPD-AFIPLEGETEV 66

  Fly   309 TSSSSTSNEKPAKT------------SRLS-ERAKKKSWYNVIYPNYKSRAEDFKKLFKDVPNDE 360
            |:....:....:||            |.|. ||.|.:|:.   :|...|:   :.|:||||..:|
Zfish    67 TARRGKAVLVRSKTFDPSLLLQIQSDSELKCERRKPQSFQ---FPRTNSQ---YHKVFKDVSEEE 125

  Fly   361 RLIVDYSCALQRDILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI 425
            :|...|:||||:|||.||||:||:|::|||:.:|..:|.::|....||.|.|.|||:::|||:.|
Zfish   126 QLRQSYTCALQKDILYQGRLFVSENWICFHSRVFGKDTKIAIPVSSVTVIKKTKTAILVPNALVI 190

  Fly   426 SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQ-FSPQEIWQHVHTCYGDELGLTTDDEDYIDP 489
            |:..:::.|.:|.|||.::.:|..|..:.:.... .:...|..|.|..:.....:.|        
Zfish   191 STALERHVFVSFLSRDTTYKVLMSVCPHMIEETPGVAQSSIRAHHHHHHLHHPAILT-------- 247

  Fly   490 TLNKTNEPDFDFQTAIDDDSYSQRQSQQSNQSNQSNPLLPQSGNSSASSGGGVRASAPRKSKTKY 554
                     .||...:.|....:||:.|..:.:.|:. .|:               ||..|||..
Zfish   248 ---------ADFSADLSDLDAPERQTGQRTEDSSSSD-CPE---------------APEYSKTPK 287

  Fly   555 FFNSSKSSANASASGS-DNNKTRESSRKLNKKMKQNAKELTLSSVKPTELSVS 606
            |   .|.|......|. |.:..:|:....|.....:|....:.:::|..||::
Zfish   288 F---QKRSQVTKRDGELDPHIKQETDSTKNLPYTASADLELMKTLRPVSLSLN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GramD1BNP_995623.2 PH-GRAM_GRAMDC 358..451 CDD:275406 41/92 (45%)
DUF4782 751..897 CDD:292635
gramd2bXP_002663092.2 PH-GRAM_GRAMDC 123..216 CDD:275406 41/92 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944155at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.