DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kl-2 and btv

DIOPT Version :10

Sequence 1:NP_001015505.5 Gene:kl-2 / 3355181 FlyBaseID:FBgn0001313 Length:4459 Species:Drosophila melanogaster
Sequence 2:XP_061516235.1 Gene:btv / 1278872 VectorBaseID:AGAMI1_005534 Length:4196 Species:Anopheles gambiae


Alignment Length:76 Identity:15/76 - (19%)
Similarity:20/76 - (26%) Gaps:41/76 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCIRIFQTPGTILAQLNEYRETLYIIFGITCLVSWLCFNLWALREFFCPTIFNSNSSSTLRHYSE 66
            ||:|...|  |.||             |..||.             ||             ....
Mosquito    29 CCVRNGVT--TTLA-------------GQKCLT-------------FC-------------DQRP 52

  Fly    67 DHLTRIKMQYI 77
            |.:|::...|:
Mosquito    53 DRVTKLDYSYV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kl-2NP_001015505.5 DHC_N1 180..749 CDD:462457
DHC_N2 1238..1646 CDD:462462
DYN1 <1478..4135 CDD:227570
AAA_6 1785..2111 CDD:463697
Dynein_C 4161..4455 CDD:465677
btvXP_061516235.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.