DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and LRRC46

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_005257832.1 Gene:LRRC46 / 90506 HGNCID:25047 Length:330 Species:Homo sapiens


Alignment Length:249 Identity:66/249 - (26%)
Similarity:100/249 - (40%) Gaps:60/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GRRLHQLEPVVLEQILTMRLEFNNILRIDHLWI------------------LPNLTKLCLNCNKI 93
            |:||..|..|..:|...|           :.|:                  |..|..:.|:...|
Human    12 GQRLCHLSLVGTQQCCGM-----------NEWVDGTSAFFSMNDSKGRFHTLDELQTVRLDREGI 65

  Fly    94 ETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNL 158
            .||.|:|.|.||..|.|..|.|::||||..:.:|..|||..|:|..:||:..|..|..:.|..||
Human    66 TTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENL 130

  Fly   159 IDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFIKSELRAEACNLY 223
            |:|::..|   |..:|.|:||.||....:..:  .:.::..||.|           |..:...:.
Human   131 IETLKLDE---FPQSLLILNLSGNSCTNQDGY--RELVTEALPLL-----------LDLDGQPVV 179

  Fly   224 YREIREIEDKQEKE----------IQARKFLEREQSEAK-----RLASSFVEHL 262
            .|.|.:.||:...:          ...|.||:..:.|..     |..::..|||
Human   180 ERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 3/36 (8%)
LRR_8 81..137 CDD:290566 23/55 (42%)
LRR_4 81..121 CDD:289563 16/39 (41%)
leucine-rich repeat 83..104 CDD:275378 8/20 (40%)
LRR_4 103..143 CDD:289563 17/39 (44%)
leucine-rich repeat 105..126 CDD:275378 9/20 (45%)
LRR_8 126..184 CDD:290566 23/57 (40%)
LRR_4 126..166 CDD:289563 15/39 (38%)
leucine-rich repeat 127..148 CDD:275378 9/20 (45%)
leucine-rich repeat 149..162 CDD:275378 5/12 (42%)
LRRC46XP_005257832.1 LRR_8 54..109 CDD:290566 23/54 (43%)
leucine-rich repeat 55..76 CDD:275378 8/20 (40%)
LRR_4 75..115 CDD:289563 17/39 (44%)
leucine-rich repeat 77..98 CDD:275378 9/20 (45%)
LRR_8 97..151 CDD:290566 21/56 (38%)
LRR_4 97..135 CDD:289563 15/37 (41%)
leucine-rich repeat 99..120 CDD:275378 9/20 (45%)
leucine-rich repeat 121..142 CDD:275378 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.