DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and DRC3

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_011522320.1 Gene:DRC3 / 83450 HGNCID:25384 Length:562 Species:Homo sapiens


Alignment Length:582 Identity:182/582 - (31%)
Similarity:299/582 - (51%) Gaps:84/582 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEF-------------------- 68
            :||.:::..:::.:......:.|..:|.:.|.::.:.:|:::|:|                    
Human     8 MEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRRKTADEPKGEQDDGQEDSQ 72

  Fly    69 NNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLF 133
            .:|||||:||...||.||.|:.|.||.||.:|.|.:|..|:||||.||.||.||||||||.||||
Human    73 EDILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLF 137

  Fly   134 SNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISA 198
            :|:|..|:::|.|..|.::|||||.||.:..|...|....|:.::|..|||::..::.:  :|.|
Human   138 NNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKM--FICA 200

  Fly   199 ILPKLNYYEYTFIKSELR---------------------AEACNLYYREIREIEDKQEKEIQARK 242
            .||.|.|.:|..|.....                     |||.:.|  .|.|:: .||..:||: 
Human   201 YLPDLMYLDYRRIDDHTASVSLSVSQPCETDSSSPQKKLAEAKHQY--SIDELK-HQENLMQAQ- 261

  Fly   243 FLEREQSEAKRL---ASSFVEHLDGHQLFDSLWRGDEDGRVLML---VGTQAQELADEYDKDIFE 301
             ||.||::.:.|   .::|||||:|..||||::..|.:|..|..   ||    ||.:.|......
Human   262 -LEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVG----ELLETYKDKFVI 321

  Fly   302 LTQEIYKLGLERFTERDEEIRDFFNNLFDGQEELQILGQNEIEWFLQFREIIFEEARIRLLKLEQ 366
            :...|::.||::..:|..|:..|...:.:..:|.|..|:.:|        ..|||..:..|...:
Human   322 ICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKI--------AKFEEKHLSSLSAIR 378

  Fly   367 NSMHGEDEDTPENLKLSDALDKLNIQFEDAINDLWQALMAQELYLHESIQESTINFHRKIAELMS 431
                       |.|:|.: ::|:.::....|::|:.|||..|:.|.|.::|:...|.|.|.:::.
Human   379 -----------EELELPN-IEKMILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVG 431

  Fly   432 KFVEQSQAFFVQLREITLHFSENMTEILTRFIST--KFALQDFD-DVPIELRVCVDDRDAILNLI 493
            .|:|..|:...|.|::..|..|.:.||   .|||  |....|.| |:|.:||....|:|.|:|.:
Human   432 LFIENVQSLMAQCRDLENHHHEKLLEI---SISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAV 493

  Fly   494 AGMKDYHTLRLDEREDTIATRTKEFVDNMIDQLNSNEVERHRSKILEINFFVEMMTDAMTSL 555
            ....|.|.|::|.|||.:.||...:...:||:::.:|:.|:|.::.|||.:::.|...:.:|
Human   494 GASHDIHLLKIDNREDELVTRINSWCTRLIDRIHKDEIMRNRKRVKEINQYIDHMQSELDNL 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 9/38 (24%)
LRR_8 81..137 CDD:290566 35/55 (64%)
LRR_4 81..121 CDD:289563 22/39 (56%)
leucine-rich repeat 83..104 CDD:275378 11/20 (55%)
LRR_4 103..143 CDD:289563 25/39 (64%)
leucine-rich repeat 105..126 CDD:275378 14/20 (70%)
LRR_8 126..184 CDD:290566 25/57 (44%)
LRR_4 126..166 CDD:289563 20/39 (51%)
leucine-rich repeat 127..148 CDD:275378 11/20 (55%)
leucine-rich repeat 149..162 CDD:275378 8/12 (67%)
DRC3XP_011522320.1 leucine-rich repeat 87..108 CDD:275378 11/20 (55%)
LRR_9 88..213 CDD:317038 59/126 (47%)
leucine-rich repeat 109..130 CDD:275378 14/20 (70%)
leucine-rich repeat 131..152 CDD:275378 11/20 (55%)
leucine-rich repeat 153..177 CDD:275378 10/23 (43%)
leucine-rich repeat 178..189 CDD:275378 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145924
Domainoid 1 1.000 133 1.000 Domainoid score I5073
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12581
Inparanoid 1 1.050 270 1.000 Inparanoid score I3012
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56411
OrthoDB 1 1.010 - - D259508at33208
OrthoFinder 1 1.000 - - FOG0006354
OrthoInspector 1 1.000 - - otm41404
orthoMCL 1 0.900 - - OOG6_104691
Panther 1 1.100 - - O PTHR45973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4624
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.