DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and AT5G22320

DIOPT Version :10

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_568416.1 Gene:AT5G22320 / 832292 AraportID:AT5G22320 Length:452 Species:Arabidopsis thaliana


Alignment Length:269 Identity:58/269 - (21%)
Similarity:102/269 - (37%) Gaps:83/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVL 130
            |.|||:..:..|....||..|.:..||::::..||.||.|..||...|.::.:..:.:||||..|
plant    48 LRFNNLTDLQGLKSCVNLKWLSVVENKLQSLNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRAL 112

  Fly   131 SLFSNKIEAIENIDML------------------------------------------------- 146
            .|..|:|.:|..:|:|                                                 
plant   113 ILNDNEISSICKLDLLKDLNSLVLSRNPISEIGDSLSKLKNLSKISLSDCRIKAIGSSLKSCSDL 177

  Fly   147 --------------------TMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFC 191
                                ..|:.:.:|||:|..:.|:|....::.|:.:|:.||||:.... .
plant   178 KELRLANNEIKALPAELAVNKRLLNLDVGNNVITQLSGLEVLGTLSCLRNLNIRGNPISDNDK-S 241

  Fly   192 LLKYISAILPKLNYY----------EYTFIKSELRAEACNLYYREIREIEDKQEKEIQAR-KFLE 245
            ..|..:.:||.:|.:          ....|:.:...|..:.|:.  :..|::|.||.:.| |..:
plant   242 AKKVRTLLLPSVNVFNAQPLEKSSRNAKHIRLDTDDETFDAYHN--KSAEEEQSKEDRKRKKSSK 304

  Fly   246 REQSEAKRL 254
            |.:||.:.:
plant   305 RNKSEEEEV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 5/15 (33%)
LRR <80..313 CDD:443914 53/255 (21%)
PPP1R42 82..>176 CDD:455733 32/162 (20%)
leucine-rich repeat 83..104 CDD:275378 7/20 (35%)
leucine-rich repeat 105..126 CDD:275378 5/20 (25%)
leucine-rich repeat 127..148 CDD:275378 8/89 (9%)
leucine-rich repeat 149..162 CDD:275378 5/12 (42%)
AT5G22320NP_568416.1 LRR 2..>243 CDD:443914 42/195 (22%)
leucine-rich repeat 21..42 CDD:275380
leucine-rich repeat 43..64 CDD:275380 5/15 (33%)
leucine-rich repeat 65..86 CDD:275380 7/20 (35%)
leucine-rich repeat 87..108 CDD:275380 5/20 (25%)
leucine-rich repeat 109..130 CDD:275380 8/20 (40%)
leucine-rich repeat 131..153 CDD:275380 0/21 (0%)
leucine-rich repeat 154..176 CDD:275380 0/21 (0%)
leucine-rich repeat 177..199 CDD:275380 0/21 (0%)
leucine-rich repeat 200..224 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.