DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and AT5G19680

DIOPT Version :10

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_197469.1 Gene:AT5G19680 / 832088 AraportID:AT5G19680 Length:328 Species:Arabidopsis thaliana


Alignment Length:187 Identity:56/187 - (29%)
Similarity:95/187 - (50%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SSYLK--HVHRGEGRRLHQLEPVVLEQILTM---RL----EFNNILRIDHLWI------------ 79
            ||.||  :|.:.|..::.::|.:...|||.:   ||    ...|..:::.||:            
plant   131 SSTLKELYVSKNEVNKIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVVNLCG 195

  Fly    80 LPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENID 144
            |..:.|:.|..|::.:::..|....|::|.||.|.|.|:|.|..||||.||.:.:||:.::::|.
plant   196 LKCIKKISLQSNRLTSMKGFEECVALEELYLSHNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQ 260

  Fly   145 MLTMLVIISLGNNLIDTVEGIER--FRFMNNLKIINLEGNPIAKRTNFCLLKYISAI 199
            .||.|..:.|.:|.|:::|.|..  ......|..|.||.||.||.::     |::|:
plant   261 NLTKLEDLWLNDNQIESLEAITEAVTGSKEKLTTIYLENNPCAKSSD-----YVAAV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 6/37 (16%)
LRR <80..313 CDD:443914 41/122 (34%)
PPP1R42 82..>176 CDD:455733 31/95 (33%)
leucine-rich repeat 83..104 CDD:275378 4/20 (20%)
leucine-rich repeat 105..126 CDD:275378 10/20 (50%)
leucine-rich repeat 127..148 CDD:275378 7/20 (35%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
AT5G19680NP_197469.1 leucine-rich repeat 19..38 CDD:275380
leucine-rich repeat 39..61 CDD:275380
leucine-rich repeat 62..88 CDD:275380
leucine-rich repeat 89..110 CDD:275380
leucine-rich repeat 111..133 CDD:275380 1/1 (100%)
PPP1R42 121..308 CDD:455733 54/181 (30%)
leucine-rich repeat 134..155 CDD:275380 5/20 (25%)
leucine-rich repeat 156..177 CDD:275380 6/20 (30%)
leucine-rich repeat 178..198 CDD:275380 3/19 (16%)
leucine-rich repeat 199..220 CDD:275380 4/20 (20%)
leucine-rich repeat 221..242 CDD:275380 10/20 (50%)
leucine-rich repeat 243..264 CDD:275380 7/20 (35%)
leucine-rich repeat 265..291 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.