DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Cep97

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_083091.1 Gene:Cep97 / 74201 MGIID:1921451 Length:856 Species:Mus musculus


Alignment Length:624 Identity:135/624 - (21%)
Similarity:228/624 - (36%) Gaps:167/624 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VDEVIYPDIEPGIINRSLIESSYLKHVHRGEG-RRLHQLEPVVLEQILTMRLEFNNILRIDHLWI 79
            ||..:.|. |..::|.|            |:| ::|....|...: :.|:.|:.|.|:::::|..
Mouse     6 VDGALAPG-EGSVVNWS------------GQGLQKLGANLPCEAD-VHTLILDKNQIIKLENLEK 56

  Fly    80 LPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENID 144
            ...|.:|.:..|::..:..:..||.|:.|||..|.|..:|.|..||:||.|:|..|.::.:|.::
Mouse    57 CKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVN 121

  Fly   145 MLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAILPKLNYYEYT 209
            ..|.|..:.|.:|.|..:..:.:   :.:||.:.|.||.|..      |:...|.||:       
Mouse   122 SCTALQHLDLSDNNIPQIGDVSK---LISLKTLLLHGNIITS------LRMAPAYLPR------- 170

  Fly   210 FIKSELRAEACNLYYREIREIEDKQEKEIQARKFLEREQSEAKRLA------------------S 256
                       ||....:.|.|.:...||   .|| ...||.::|:                  .
Mouse   171 -----------NLSILSLAENEIRDLNEI---SFL-ASLSELEQLSIMNNPCVMATPSIPGFDYR 220

  Fly   257 SFV-------EHLDGHQLF--DSL---W-------RGDEDGRVLMLVG--------TQAQELADE 294
            .|:       ..|||:.:.  :||   |       |....|:.:.||.        |.|..|...
Mouse   221 PFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRSYRPGQHIQLVQYLATVCPLTSALGLQTA 285

  Fly   295 YDKDIFELTQEIYKLGLERFTER-------DEEI--------------------RDFFNNLFDGQ 332
            .|..:.::      |..:||.:|       |||:                    :||    .:.:
Mouse   286 EDAKLEKI------LSKQRFHQRQLMSQSQDEELSPLAAVETRVHRTPECSSPGQDF----QESE 340

  Fly   333 EELQI-----LGQNEIEWFLQFREIIFEEARIRLLKLEQNSMHGEDEDTPENLKLSDALDKLNIQ 392
            ..|||     :..|:.:.:......   .|.....:..:|.:|.||..|.|: ||:.:|......
Mouse   341 PVLQINSWVGISSNDDQLYAVKNNF---PAAAHAARYSRNDLHLEDIQTDED-KLNCSLLSSEST 401

  Fly   393 FEDAINDLWQALMAQELYLHESIQESTINFHRKIAELMSKFVE--QSQAFFVQLREITLHFSENM 455
            |....:.|.......||.|      ..||...:..:...:|.:  ::|.......:.....||:.
Mouse   402 FMPVASGLSPVSPTVELRL------QGINLGLEDDDGADEFTKGLENQDEDKDKEKSLWDMSESC 460

  Fly   456 TEILTRFISTKFALQDFDDVPIELRVCVDDRDAILNLIAGMKDYHTL-RLDEREDTIATRTKEFV 519
            .|:|.|.|||:.:         |....:....:::...|..:|.|:| .|.|.....|:||    
Mouse   461 VEMLKRKISTEVS---------EAAGLLPCPKSVIISAALKEDTHSLTSLPESAGHSASRT---- 512

  Fly   520 DNMIDQLNSNEVERHRSKILEINFFVEMMTDAMTSLPHD 558
                 :.||.|.   .|......|...::|....:|..|
Mouse   513 -----EANSEEA---MSPATSEKFPCRILTQRPAALGQD 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 5/18 (28%)
LRR_8 81..137 CDD:290566 20/55 (36%)
LRR_4 81..121 CDD:289563 12/39 (31%)
leucine-rich repeat 83..104 CDD:275378 4/20 (20%)
LRR_4 103..143 CDD:289563 17/39 (44%)
leucine-rich repeat 105..126 CDD:275378 9/20 (45%)
LRR_8 126..184 CDD:290566 16/57 (28%)
LRR_4 126..166 CDD:289563 11/39 (28%)
leucine-rich repeat 127..148 CDD:275378 6/20 (30%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
Cep97NP_083091.1 leucine-rich repeat 17..37 CDD:275380 6/31 (19%)
LRR 1 37..58 5/21 (24%)
leucine-rich repeat 38..59 CDD:275380 5/20 (25%)
LRR_4 58..99 CDD:289563 12/40 (30%)
LRR 2 59..80 3/20 (15%)
leucine-rich repeat 60..81 CDD:275380 4/20 (20%)
LRR_8 80..136 CDD:290566 21/55 (38%)
LRR_4 80..122 CDD:289563 17/41 (41%)
LRR 3 81..102 8/20 (40%)
leucine-rich repeat 82..103 CDD:275380 9/20 (45%)
LRR_4 103..144 CDD:289563 11/40 (28%)
LRR 4 103..124 6/20 (30%)
leucine-rich repeat 104..125 CDD:275380 6/20 (30%)
LRR 5 125..146 4/23 (17%)
leucine-rich repeat 126..147 CDD:275380 4/23 (17%)
LRR_8 147..206 CDD:290566 21/86 (24%)
LRR 6 147..168 8/26 (31%)
leucine-rich repeat 148..171 CDD:275380 10/46 (22%)
LRR 7 171..192 8/24 (33%)
leucine-rich repeat 172..196 CDD:275380 7/27 (26%)
LRR 8 196..205 2/8 (25%)
CCP110-binding. /evidence=ECO:0000250 300..742 55/279 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..451 2/20 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..525 10/38 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 646..672
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 737..840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.