DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Ppp1r7

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_075689.1 Gene:Ppp1r7 / 66385 MGIID:1913635 Length:361 Species:Mus musculus


Alignment Length:278 Identity:76/278 - (27%)
Similarity:124/278 - (44%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QINNSEVQKPLVDEVIYPDIEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEFN 69
            :|...||.|.:....:..::...|.|...::|.....::..:.:::..||  .|.::..:.:.||
Mouse    91 KIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLE--ALTELEVLDISFN 153

  Fly    70 NILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFS 134
            .:..|:.:..|..|.||.|..|||..||||..|..|:.|.|..|.|..|||:|||.|||.|.|..
Mouse   154 MLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGK 218

  Fly   135 NKIEAIENIDMLTMLVIIS----------------------LGNNLIDTVEGIERFRFMNNLKII 177
            |||..::|:|.||.|.::|                      |.||.|:.:||:|.   .|.|.::
Mouse   219 NKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLEN---NNKLTML 280

  Fly   178 NLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFIKSELR-AEACNLYYREIREIEDKQEKEIQAR 241
            ::..|.|.|..|...|..:.......|..|......||: |.:....|.|    .:..:|:.|.|
Mouse   281 DIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLE----RNPLQKDPQYR 341

  Fly   242 KFLEREQSEAKRLASSFV 259
            :.:.......:::.:::|
Mouse   342 RKVMLALPSVRQIDATYV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 4/18 (22%)
LRR_8 81..137 CDD:290566 29/55 (53%)
LRR_4 81..121 CDD:289563 19/39 (49%)
leucine-rich repeat 83..104 CDD:275378 12/20 (60%)
LRR_4 103..143 CDD:289563 19/39 (49%)
leucine-rich repeat 105..126 CDD:275378 11/20 (55%)
LRR_8 126..184 CDD:290566 24/79 (30%)
LRR_4 126..166 CDD:289563 20/61 (33%)
leucine-rich repeat 127..148 CDD:275378 10/20 (50%)
leucine-rich repeat 149..162 CDD:275378 6/34 (18%)
Ppp1r7NP_075689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
LRR 1 78..99 3/7 (43%)
LRR_4 99..140 CDD:289563 4/40 (10%)
LRR 2 100..121 2/20 (10%)
leucine-rich repeat 101..122 CDD:275380 2/20 (10%)
LRR_4 121..163 CDD:289563 7/43 (16%)
LRR_8 122..177 CDD:290566 13/56 (23%)
LRR 3 122..143 3/22 (14%)
leucine-rich repeat 123..144 CDD:275380 3/22 (14%)
LRR_4 143..185 CDD:289563 15/41 (37%)
LRR 4 144..165 3/20 (15%)
leucine-rich repeat 145..166 CDD:275380 4/20 (20%)
LRR_8 165..221 CDD:290566 29/55 (53%)
LRR 5 166..187 11/20 (55%)
leucine-rich repeat 167..188 CDD:275380 12/20 (60%)
LRR_4 188..227 CDD:289563 19/38 (50%)
LRR 6 188..209 10/20 (50%)
leucine-rich repeat 189..210 CDD:275380 11/20 (55%)
LRR_4 209..251 CDD:289563 14/41 (34%)
LRR 7 210..231 10/20 (50%)
leucine-rich repeat 211..232 CDD:275380 10/20 (50%)
LRR_8 231..287 CDD:290566 13/58 (22%)
LRR 8 232..253 2/20 (10%)
leucine-rich repeat 233..254 CDD:275380 2/20 (10%)
LRR_4 254..295 CDD:289563 13/43 (30%)
LRR 9 254..275 7/23 (30%)
leucine-rich repeat 255..276 CDD:275380 7/23 (30%)
LRR_4 276..317 CDD:289563 8/40 (20%)
LRR 10 276..297 5/20 (25%)
leucine-rich repeat 277..298 CDD:275380 6/20 (30%)
LRR 11 298..319 3/20 (15%)
LRRcap 337..355 CDD:197729 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.