DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and lrrc61

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001036219.1 Gene:lrrc61 / 553439 ZFINID:ZDB-GENE-060616-245 Length:260 Species:Danio rerio


Alignment Length:286 Identity:64/286 - (22%)
Similarity:110/286 - (38%) Gaps:67/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEFNNILRIDHLWILPNLTKLCLNCNKIETI 96
            |.|.:..||. |.||         ..||.||.::|:...|..:..:....||.:|.|:.|.|..:
Zfish    13 SKITTMLLKS-HTGE---------FDLESILFLKLKNLGIYDLGCIGECINLERLDLSGNNITNL 67

  Fly    97 ENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDT 161
            ..:..|..|..||||.|.|..:|.|.|..:|:.|::..|.|.:::|:..|..|            
Zfish    68 GPLSPLRRLLSLNLSANRISNLEPLATCESLQSLNVAGNVISSVDNLHSLKSL------------ 120

  Fly   162 VEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFI---KSELRAEACNLY 223
             ..:|..|..:|.....   ||:.|..::..|  |..|.|.:...:...:   .|:|        
Zfish   121 -RRLENIRLKDNTYNFT---NPVCKNPSYRPL--ILEIFPNMKVLDGERVVGRGSDL-------- 171

  Fly   224 YREIREIEDKQEKEIQARKFLEREQSEAKRLASSFVEHLDGHQLFDSLWRGDEDGRVLM------ 282
            |:..::|:|    .|:|..:...:..|. |....:|:        ||.|........::      
Zfish   172 YQLCKDIDD----SIKAGMYKNGQLLEV-RETEPWVD--------DSFWEIKRSNNAIVDEAYKQ 223

  Fly   283 ---------LVGTQAQELADEYDKDI 299
                     |:.::|..|..:.:::|
Zfish   224 FSDVLHECRLLNSRAGHLISQNERNI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 2/18 (11%)
LRR_8 81..137 CDD:290566 20/55 (36%)
LRR_4 81..121 CDD:289563 15/39 (38%)
leucine-rich repeat 83..104 CDD:275378 6/20 (30%)
LRR_4 103..143 CDD:289563 14/39 (36%)
leucine-rich repeat 105..126 CDD:275378 10/20 (50%)
LRR_8 126..184 CDD:290566 11/57 (19%)
LRR_4 126..166 CDD:289563 7/39 (18%)
leucine-rich repeat 127..148 CDD:275378 6/20 (30%)
leucine-rich repeat 149..162 CDD:275378 1/12 (8%)
lrrc61NP_001036219.1 leucine-rich repeat 54..81 CDD:275378 8/26 (31%)
leucine-rich repeat 98..122 CDD:275378 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.