DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Lrrc61

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001102701.1 Gene:Lrrc61 / 500111 RGDID:1561800 Length:259 Species:Rattus norvegicus


Alignment Length:290 Identity:59/290 - (20%)
Similarity:107/290 - (36%) Gaps:87/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PDIEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMRLEFNNILRIDHLWILPNLTKL 86
            |..:||.....:|....||. |.||         ..|:.||.::|....::.:.           
  Rat     4 PGEKPGEAEALIITPQLLKS-HSGE---------FALDSILLLKLRGLGVVDLG----------- 47

  Fly    87 CLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVI 151
            ||.          |.| ||:.|:||.|.:..:..|.:|..|.||::.:|::..:|.:.....|..
  Rat    48 CLG----------ECL-NLEWLDLSGNALTHLGPLASLHQLAVLNVSNNRLTGLEPLAACENLQS 101

  Fly   152 ISLGNNLIDT---------VEGIERFRF------MNNLKIIN----------------LEGNPIA 185
            ::...||:..         ::|:|..|.      ::|...:|                ::|..::
  Rat   102 LNAAGNLLTNPGQLQCLAGLQGLEHLRLRDPLARLSNPLCVNPSYWAAVRELLPGLKVIDGERVS 166

  Fly   186 KRTN----FC-----LLKYISAILPKL---------NYYE-YTFIKSELRAEACNLYYREIREIE 231
            .|.:    .|     .|:..:::.|:.         .|:| :....|.:..|||..:...::|..
  Rat   167 GRGSELYQLCRDLDSSLRSSTSLGPRAIEVQPWVEPGYWESWPIRSSSILEEACRQFQDTLQECL 231

  Fly   232 DKQEKEIQARKFLEREQSEAK--RLASSFV 259
            |...   ||...|.:.|...:  :..||||
  Rat   232 DLDR---QASDSLAQAQQALRPAKTTSSFV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 1/18 (6%)
LRR_8 81..137 CDD:290566 16/55 (29%)
LRR_4 81..121 CDD:289563 10/39 (26%)
leucine-rich repeat 83..104 CDD:275378 4/20 (20%)
LRR_4 103..143 CDD:289563 13/39 (33%)
leucine-rich repeat 105..126 CDD:275378 7/20 (35%)
LRR_8 126..184 CDD:290566 14/88 (16%)
LRR_4 126..166 CDD:289563 9/48 (19%)
leucine-rich repeat 127..148 CDD:275378 5/20 (25%)
leucine-rich repeat 149..162 CDD:275378 3/21 (14%)
Lrrc61NP_001102701.1 PPP1R42 <49..166 CDD:411060 25/127 (20%)
leucine-rich repeat 55..76 CDD:275380 7/20 (35%)
leucine-rich repeat 77..98 CDD:275380 5/20 (25%)
leucine-rich repeat 99..123 CDD:275380 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.