DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and cep97

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_009303333.2 Gene:cep97 / 386640 ZFINID:ZDB-GENE-031030-11 Length:631 Species:Danio rerio


Alignment Length:323 Identity:72/323 - (22%)
Similarity:116/323 - (35%) Gaps:91/323 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HRGEG------RRLHQLEPVVL---EQILTMRLEFNNILRIDHLWILPNLTKLCLNCNKIETIEN 98
            |||.|      |.|.:|||.:.   ....|:.|:.|.:::::||...|:|.:|.:.||::..:.|
Zfish    33 HRGPGVLDLSARGLQRLEPQLFRPDSHTHTLILDQNQLMKLEHLEHNPDLQQLSVACNRLVRMMN 97

  Fly    99 IEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVE 163
            :..||.|:.|:|..|.|..||.|..|..||.|:|..|.|:.:|.:.....|..:.|.:|.|..:.
Zfish    98 VCRLTQLRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIKVMEQLHHCVSLQHLDLSDNNISQIG 162

  Fly   164 GIERFRFMN---------------------NLKIINLEGNPIAKRTNFCLLKYI----------- 196
            .:.|...:.                     :|::::|..|.|...|..|.|..:           
Zfish   163 DVSRLSALQTLLLHGNIITTLRSAPAHLPAHLRVLSLAENEIRDLTEVCYLAPVRGLQQLSLLSN 227

  Fly   197 -------SAILPKLNYYEYTFI---------------KSELRAE--------------------- 218
                   ||:   .:|..|...               |..|:||                     
Zfish   228 PCVSCVSSAV---CDYRPYVLSWCLGLELLDGVAVTQKEGLKAEWLYSQGRGRVFRPGEHTQLLQ 289

  Fly   219 ----ACNLYYREIREIEDKQEKEIQARKFLEREQSEAKRLASSFVEHLDGHQLFDSLWRGDED 277
                .|....|:....:.|.||.:..::..:.:.........|...|||..||..|....||:
Zfish   290 YLSRTCPAAARQPPAEDAKLEKILNKQRHHQNQLQHTHHQTPSRPTHLDVQQLHQSTPDEDEE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 5/18 (28%)
LRR_8 81..137 CDD:290566 22/55 (40%)
LRR_4 81..121 CDD:289563 15/39 (38%)
leucine-rich repeat 83..104 CDD:275378 6/20 (30%)
LRR_4 103..143 CDD:289563 17/39 (44%)
leucine-rich repeat 105..126 CDD:275378 9/20 (45%)
LRR_8 126..184 CDD:290566 15/78 (19%)
LRR_4 126..166 CDD:289563 11/39 (28%)
leucine-rich repeat 127..148 CDD:275378 7/20 (35%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
cep97XP_009303333.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.