DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Lrrc43

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001028633.1 Gene:Lrrc43 / 381741 MGIID:2685907 Length:667 Species:Mus musculus


Alignment Length:444 Identity:97/444 - (21%)
Similarity:163/444 - (36%) Gaps:116/444 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PLVDEVIYPDIEP-----GIINRSLIESSYLKHVHRGEGRRLHQL---EPVVLEQILTMRLEFNN 70
            |..:|.:.|:.|.     |::..:....:.||.. ..|.|.|.:|   .|::::.  |....:..
Mouse    66 PKEEETLVPEEETVEALLGLVRSNHSPWAMLKDA-SAEDRFLRELAIQNPLMIKD--TFFYSYFR 127

  Fly    71 ILRI----------DHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTL- 124
            .||:          |.|..| .|.:|.|:.||||.|:...:...||.|.|..|.|..:|.|.:. 
Mouse   128 SLRVVNKGVSLVDKDLLKFL-KLEELVLSANKIEEIDANNLPPTLKVLELYGNLIASMECLCSAP 191

  Fly   125 -VNLEVLSLFSNK-IEAIENIDMLT----MLVIISLG-NNLIDTVEGIERFRFMNNLKIINLEGN 182
             ..|:.|.|..|| :..:|::.:.:    .||.:.|| |||.|....|.....:.:|:::.|:||
Mouse   192 PPRLQHLGLGHNKLLGPLESLYVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGN 256

  Fly   183 PIA-----------KRTNFCLLKYISAILPKLNYYEYTFIKSELRAEACNLYYR--EIREIEDKQ 234
            |::           ...:.|:|..|:....:.:.:....|..:|.|........  .:|.:.|. 
Mouse   257 PLSLVPYYRGFTIDSLAHLCVLDDITVSPNEKHQFRGLNIHGDLLAREAQFVVTIGNVRGVLDS- 320

  Fly   235 EKEIQARKFLEREQ-------SEAKRLASSFVEHLDGHQLFDSLWRGDED--GRVLMLV-GTQAQ 289
                   ..|:.|.       |.:..:...|||              |||  ..|..|| .|...
Mouse   321 -------SILDPEPGPDGPFISYSYYVTYDFVE--------------DEDMERNVSGLVEATHHD 364

  Fly   290 ELADEYDKDIFELTQEIYK----------LGLERF-----TERDEEIRDF----FNNLFDGQEEL 335
            .:.||.||......:|..:          .|.:||     .|..:|:.:|    .:.:.:|..| 
Mouse   365 SVLDEIDKHFSGTDEEDQQEDPLDGRHRHRGRQRFHPGSTEEMSKELSEFIAKEMSQMAEGSVE- 428

  Fly   336 QILGQNEIEWFLQFREIIFEEARIRLLKLEQNSMHGEDEDTPENLKLSDALDKL 389
              .|..|::|                   .:.|:.......|:::..|:.|.||
Mouse   429 --SGITEVDW-------------------SETSISIHSAPLPQSIDSSEELAKL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 6/28 (21%)
LRR_8 81..137 CDD:290566 21/58 (36%)
LRR_4 81..121 CDD:289563 15/39 (38%)
leucine-rich repeat 83..104 CDD:275378 8/20 (40%)
LRR_4 103..143 CDD:289563 14/42 (33%)
leucine-rich repeat 105..126 CDD:275378 8/22 (36%)
LRR_8 126..184 CDD:290566 19/63 (30%)
LRR_4 126..166 CDD:289563 14/45 (31%)
leucine-rich repeat 127..148 CDD:275378 6/25 (24%)
leucine-rich repeat 149..162 CDD:275378 8/13 (62%)
Lrrc43NP_001028633.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LRR 1 148..169 8/20 (40%)
LRR <154..>263 CDD:227223 34/108 (31%)
LRR 2 170..191 8/20 (40%)
leucine-rich repeat 171..194 CDD:275378 8/22 (36%)
LRR 3 194..213 6/18 (33%)
leucine-rich repeat 195..221 CDD:275378 6/25 (24%)
LRR 4 221..242 9/20 (45%)
leucine-rich repeat 222..247 CDD:275378 9/24 (38%)
leucine-rich repeat 248..259 CDD:275378 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..407 4/32 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 616..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.