DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and LRRC9

DIOPT Version :10

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001342201.1 Gene:LRRC9 / 341883 HGNCID:19848 Length:1494 Species:Homo sapiens


Alignment Length:52 Identity:15/52 - (28%)
Similarity:27/52 - (51%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CLGVVNPQSSGIGGGFLMTYFD-QKSGDCYSIDARETAPAAASRDMFLNDSD 186
            |.|..|| .||:||...:::.: |...||:  :.::.:.:...|. ||.:.|
Human   221 CAGCTNP-ISGLGGTKYISFEERQWHNDCF--NCKKCSLSLVGRG-FLTERD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378
LRR <80..313 CDD:443914 15/52 (29%)
PPP1R42 82..>176 CDD:455733 11/40 (28%)
leucine-rich repeat 83..104 CDD:275378
leucine-rich repeat 105..126 CDD:275378
leucine-rich repeat 127..148 CDD:275378 6/11 (55%)
leucine-rich repeat 149..162 CDD:275378 2/13 (15%)
LRRC9NP_001342201.1 leucine-rich repeat 37..51 CDD:275380
PPP1R42 55..236 CDD:455733 8/15 (53%)
leucine-rich repeat 56..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380
leucine-rich repeat 100..121 CDD:275380
leucine-rich repeat 122..143 CDD:275380
leucine-rich repeat 144..166 CDD:275380
leucine-rich repeat 192..223 CDD:275381 1/1 (100%)
LRR 631..1016 CDD:443914
leucine-rich repeat 698..717 CDD:275380
leucine-rich repeat 718..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 762..788 CDD:275380
leucine-rich repeat 789..846 CDD:275380
leucine-rich repeat 847..910 CDD:275380
PPP1R42 878..1066 CDD:455733
leucine-rich repeat 911..932 CDD:275380
leucine-rich repeat 933..954 CDD:275380
leucine-rich repeat 955..978 CDD:275380
leucine-rich repeat 1026..1094 CDD:275380
PPP1R42 1116..1361 CDD:455733
leucine-rich repeat 1141..1166 CDD:275380
leucine-rich repeat 1167..1203 CDD:275380
leucine-rich repeat 1204..1227 CDD:275380
leucine-rich repeat 1228..1249 CDD:275380
leucine-rich repeat 1250..1273 CDD:275380
leucine-rich repeat 1274..1295 CDD:275380
leucine-rich repeat 1296..1320 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.