DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Lrrc23

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001381276.1 Gene:Lrrc23 / 312707 RGDID:1304779 Length:345 Species:Rattus norvegicus


Alignment Length:250 Identity:67/250 - (26%)
Similarity:122/250 - (48%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NNSEVQKPLVDEVIYPDIEPGIINRSLIESSYLKHVHRG----EGRRLHQLEPVVLEQILTMRLE 67
            :.::::...::|:.|..|.....|: :.::..:.|...|    :|.|:||:..:..|:       
  Rat   123 DGNQLRSARLNELPYLQIASFSYNQ-ITDTEGIIHPRLGSLDLKGNRIHQVTGLDPER------- 179

  Fly    68 FNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSL 132
                        |.||..|.|..|::||...|. |..||:|.|:.|.::|:|.|:.|.||..|.|
  Rat   180 ------------LTNLHTLELRANQLETTIGIN-LPKLKNLYLAQNLLKKVEGLENLSNLTTLHL 231

  Fly   133 FSNKIEAIENIDM-LTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNF---CLL 193
            ..|:||.::.... :..|..::|.:|:|..:..:.:.|.:..|:.:.|..||.|..|::   .|:
  Rat   232 RDNQIETLDGFSKEMKSLQYLNLRSNMISDLGELAKLRDLPKLRALVLLDNPCADETDYRQEALV 296

  Fly   194 KYISAILPKLN--YYEYTFIKSELRAEACNLYYREIRE-IEDKQEKEIQARKFLE 245
            :  .|.|.:|:  |||     .|.||||     .|||: ::::||:|:...:.:|
  Rat   297 Q--MAHLERLDKEYYE-----DEDRAEA-----EEIRQRLKEEQEQELDPDQDME 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 1/18 (6%)
LRR_8 81..137 CDD:290566 23/55 (42%)
LRR_4 81..121 CDD:289563 16/39 (41%)
leucine-rich repeat 83..104 CDD:275378 8/20 (40%)
LRR_4 103..143 CDD:289563 16/39 (41%)
leucine-rich repeat 105..126 CDD:275378 9/20 (45%)
LRR_8 126..184 CDD:290566 15/58 (26%)
LRR_4 126..166 CDD:289563 11/40 (28%)
leucine-rich repeat 127..148 CDD:275378 6/21 (29%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
Lrrc23NP_001381276.1 leucine-rich repeat 75..94 CDD:275380
PPP1R42 80..306 CDD:411060 52/205 (25%)
leucine-rich repeat 95..116 CDD:275380
leucine-rich repeat 117..137 CDD:275380 1/13 (8%)
leucine-rich repeat 138..158 CDD:275380 3/20 (15%)
leucine-rich repeat 159..182 CDD:275380 7/41 (17%)
leucine-rich repeat 183..203 CDD:275380 8/20 (40%)
leucine-rich repeat 204..225 CDD:275380 9/20 (45%)
leucine-rich repeat 226..248 CDD:275380 6/21 (29%)
leucine-rich repeat 249..273 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.