DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and Lrguk

DIOPT Version :9

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_017448017.1 Gene:Lrguk / 296968 RGDID:1308226 Length:1271 Species:Rattus norvegicus


Alignment Length:583 Identity:137/583 - (23%)
Similarity:227/583 - (38%) Gaps:175/583 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EVIYPDIEPGIINRSLIESSYLK-HVHRGE----GRRLHQLE-----PVVLE------------- 59
            |.:|.::  .:.:..||:.|.|. :||..:    |.|:..|.     |.:||             
  Rat   125 EQVYRNL--NLSHCELIDVSILSGYVHLQKLNLSGNRIEDLSCVSCMPYLLELNASQNRLTTFFN 187

  Fly    60 ----QILTMRLEF--NNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKI 118
                |.|..:::|  |.|..:..|.....||:|.|:.|:||.|..:|...:|..|:|:.|.|..|
  Rat   188 FKPPQNLKQKVDFSSNQISEMYDLSAYHTLTQLILDNNEIEEITGLEKCISLTHLSLAGNRITTI 252

  Fly   119 ENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNP 183
            :.|.|| .::|||:.:|:||.|..::.|..|..:.|.:|.|.::.|:|..   :.|::||||.|.
  Rat   253 KGLGTL-PIKVLSVSNNQIETITGLEELKALQNLDLSHNQISSLHGLENH---DLLEVINLEDNK 313

  Fly   184 IAKRTNFCLLKYIS--AILPKLNYY--------EYTF----------------IKSELRAEACNL 222
            |.:.:.   ::||.  .||..||..        ||.|                ||.|.:..|.|.
  Rat   314 IKELSE---IEYIENLPILRVLNLLRNPIQTKPEYWFFVIFMLLRLTELDQQKIKVEEKVYAVNK 375

  Fly   223 YYREIREIEDKQEKEIQARKFLE---REQSEAKRLASSFVEHLD-------------------GH 265
            |        |...:.:.|:..:.   ...|:.:|:..|.:..||                   .|
  Rat   376 Y--------DPPPEVVAAQDHMTHVVNSMSQPQRIFDSTLPSLDAPYPMLILTGPEACGKRELAH 432

  Fly   266 QL---FDSLWR------------GDEDGRVLMLVGTQAQELADE---YDKDIFELTQEIYKLGLE 312
            :|   |.:.:|            |:.|......|   :||:.||   ..|.|.......:..||.
  Rat   433 RLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFV---SQEVFDEMLSMGKFILTFNYGNHNYGLN 494

  Fly   313 RFT----ERD----------EEIRDFFNNLFDGQEELQI-LGQNEIEWFLQFREIIFEEARIRLL 362
            |.|    .||          |.||....:.|:.:..|.: :.:.:.|.:|: |:.:|..|.|.: 
  Rat   495 RDTVEGIARDGLASCIHMELEGIRSLKYSYFEPRYILVVPMDKEKYEGYLR-RKGLFSRAEIEI- 557

  Fly   363 KLEQNSMHGEDEDTPENLKLS---DAL---DKLNIQFEDAINDLWQALMAQELYLHESIQE---- 417
                 ::...|.....|.|..   ||:   |.|:|.::..     ..|:.:.|.|.|:.::    
  Rat   558 -----AVSRVDLYVKVNRKFPGYFDAVINADDLDIAYQKL-----SELIREYLGLTETAKKGLAP 612

  Fly   418 -----------STINFH-----RKIAELMS------KFVE-QSQAFFVQLREITLHFSENMTE 457
                       |.:..|     |::|.|.:      .|:| |..|...:.:..||..|:::||
  Rat   613 TAGASSSKKTVSGVPAHLVPSPRRLARLQADGQKTEAFLEVQPHAMIPENQNPTLPQSQDLTE 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 4/20 (20%)
LRR_8 81..137 CDD:290566 22/55 (40%)
LRR_4 81..121 CDD:289563 15/39 (38%)
leucine-rich repeat 83..104 CDD:275378 9/20 (45%)
LRR_4 103..143 CDD:289563 16/39 (41%)
leucine-rich repeat 105..126 CDD:275378 9/20 (45%)
LRR_8 126..184 CDD:290566 20/57 (35%)
LRR_4 126..166 CDD:289563 13/39 (33%)
leucine-rich repeat 127..148 CDD:275378 8/20 (40%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
LrgukXP_017448017.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.