Sequence 1: | NP_001015502.3 | Gene: | Ppr-Y / 3355180 | FlyBaseID: | FBgn0046697 | Length: | 569 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004201.1 | Gene: | Lrrc46 / 287653 | RGDID: | 1303311 | Length: | 323 | Species: | Rattus norvegicus |
Alignment Length: | 233 | Identity: | 67/233 - (28%) |
---|---|---|---|
Similarity: | 107/233 - (45%) | Gaps: | 36/233 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 EGRRLHQLEPVVLEQILTMRLEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNL 110
Fly 111 SFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLK 175
Fly 176 IINLEGNPIAKRTNFCLLKYISAILPKLNYYEYTFIKSELRAEACNLYYREIREIEDK---QEKE 237
Fly 238 IQAR-----------KFLERE--QSEAKRLASSFVEHL 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppr-Y | NP_001015502.3 | leucine-rich repeat | 63..82 | CDD:275378 | 3/18 (17%) |
LRR_8 | 81..137 | CDD:290566 | 21/55 (38%) | ||
LRR_4 | 81..121 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 83..104 | CDD:275378 | 7/20 (35%) | ||
LRR_4 | 103..143 | CDD:289563 | 16/39 (41%) | ||
leucine-rich repeat | 105..126 | CDD:275378 | 8/20 (40%) | ||
LRR_8 | 126..184 | CDD:290566 | 22/57 (39%) | ||
LRR_4 | 126..166 | CDD:289563 | 15/39 (38%) | ||
leucine-rich repeat | 127..148 | CDD:275378 | 9/20 (45%) | ||
leucine-rich repeat | 149..162 | CDD:275378 | 5/12 (42%) | ||
Lrrc46 | NP_001004201.1 | LRR 1 | 49..70 | 6/20 (30%) | |
LRR_4 | 50..89 | CDD:289563 | 15/38 (39%) | ||
leucine-rich repeat | 50..71 | CDD:275378 | 7/20 (35%) | ||
LRR_8 | 70..126 | CDD:290566 | 21/55 (38%) | ||
LRR_4 | 71..110 | CDD:289563 | 16/38 (42%) | ||
LRR 2 | 71..92 | 9/20 (45%) | |||
leucine-rich repeat | 72..93 | CDD:275378 | 8/20 (40%) | ||
LRR_4 | 92..130 | CDD:289563 | 15/37 (41%) | ||
LRR 3 | 93..114 | 8/20 (40%) | |||
leucine-rich repeat | 94..115 | CDD:275378 | 9/20 (45%) | ||
LRR 4 | 115..135 | 7/22 (32%) | |||
leucine-rich repeat | 116..137 | CDD:275378 | 7/23 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 252..323 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166339651 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |