Sequence 1: | NP_001015502.3 | Gene: | Ppr-Y / 3355180 | FlyBaseID: | FBgn0046697 | Length: | 569 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006505721.1 | Gene: | Lrrc23 / 16977 | MGIID: | 1315192 | Length: | 370 | Species: | Mus musculus |
Alignment Length: | 251 | Identity: | 59/251 - (23%) |
---|---|---|---|
Similarity: | 119/251 - (47%) | Gaps: | 46/251 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 NNSEVQKPLVDEVIYPDIEPGIINRSLIESSYLKHVHRG----EGRRLHQ---LEPVVLEQILTM 64
Fly 65 RLEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEV 129
Fly 130 LSLFSNKIEAIENIDM-LTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNF--- 190
Fly 191 CLLKYISAILPKLNYYEYTFIKSELRAEACNLYYREIRE-IEDKQEKEIQARKFLE 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppr-Y | NP_001015502.3 | leucine-rich repeat | 63..82 | CDD:275378 | 1/18 (6%) |
LRR_8 | 81..137 | CDD:290566 | 19/55 (35%) | ||
LRR_4 | 81..121 | CDD:289563 | 12/39 (31%) | ||
leucine-rich repeat | 83..104 | CDD:275378 | 5/20 (25%) | ||
LRR_4 | 103..143 | CDD:289563 | 16/39 (41%) | ||
leucine-rich repeat | 105..126 | CDD:275378 | 9/20 (45%) | ||
LRR_8 | 126..184 | CDD:290566 | 15/58 (26%) | ||
LRR_4 | 126..166 | CDD:289563 | 11/40 (28%) | ||
leucine-rich repeat | 127..148 | CDD:275378 | 6/21 (29%) | ||
leucine-rich repeat | 149..162 | CDD:275378 | 4/12 (33%) | ||
Lrrc23 | XP_006505721.1 | leucine-rich repeat | 100..119 | CDD:275380 | |
internalin_A | 105..>311 | CDD:380193 | 45/186 (24%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | |||
leucine-rich repeat | 142..162 | CDD:275380 | 1/13 (8%) | ||
leucine-rich repeat | 163..183 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 184..207 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 208..228 | CDD:275380 | 6/42 (14%) | ||
leucine-rich repeat | 229..250 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 251..273 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 274..298 | CDD:275380 | 5/23 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167836018 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |