DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppr-Y and LRGUK

DIOPT Version :10

Sequence 1:NP_001015502.3 Gene:Ppr-Y / 3355180 FlyBaseID:FBgn0046697 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001352629.1 Gene:LRGUK / 136332 HGNCID:21964 Length:1131 Species:Homo sapiens


Alignment Length:394 Identity:103/394 - (26%)
Similarity:160/394 - (40%) Gaps:120/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLF 133
            |.|..|..|.....||||.|:.|:||.|..:||..||..|:|:.|.|..|..|:.| .:::|.|.
Human   203 NQISEICDLSAYHALTKLILDGNEIEEISGLEMCNNLIHLSLANNKITTINGLNKL-PIKILCLS 266

  Fly   134 SNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYIS- 197
            :|:||.|..::.|..|..:.|.:|.|.:::|:|..   :.|::||||.|.||:...   ::||. 
Human   267 NNQIEMITGLEDLKALQNLDLSHNQISSLQGLENH---DLLEVINLEDNKIAELRE---IEYIKN 325

  Fly   198 -AILPKLNYY--------EYTF----------------IKSELRAEACNLYYREIREIEDKQEKE 237
             .||..||..        ||.|                ||.|.:..|.|.|        |...:.
Human   326 LPILRVLNLLENPIQEKSEYWFFVIFMLLRLTELDQKKIKVEEKVSAVNKY--------DPPPEV 382

  Fly   238 IQARKFLEREQSEAKRLASSFVEHLDGHQLFDS-LWRGDEDGRVLMLVGTQA---QELA------ 292
            :.|       |.....:.:|.::   ..::||| |...|....:|:|.|.:|   :|||      
Human   383 VAA-------QDHLTHVVNSVMQ---PQRIFDSTLPSLDAPYPMLILAGPEACGKRELAHRLCRQ 437

  Fly   293 ---------------------DEYD-----KDIFE---------LTQEI--YKLGLERFT----E 316
                                 |..|     :|:|:         ||...  :|.||.|.|    .
Human   438 FSTYFRYGACHTTRPPYFGEGDRVDYHFISQDVFDEMVNMGKFILTFSYGNHKYGLNRDTVEGIA 502

  Fly   317 RD----------EEIRDFFNNLFDGQEELQI-LGQNEIEWFLQFR------EIIFEEARIRL-LK 363
            ||          |.:|....:.|:.:..|.: :.:.:.|.:|:.:      ||.|..:|:.| :|
Human   503 RDGLASCIHMEIEGVRSLKYSYFEPRYILVVPMNKEKYEGYLRRKGLFSRAEIEFAVSRVDLYIK 567

  Fly   364 LEQN 367
            :.||
Human   568 INQN 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppr-YNP_001015502.3 leucine-rich repeat 63..82 CDD:275378 4/12 (33%)
LRR <80..313 CDD:443914 81/305 (27%)
PPP1R42 82..>176 CDD:455733 34/93 (37%)
leucine-rich repeat 83..104 CDD:275378 11/20 (55%)
leucine-rich repeat 105..126 CDD:275378 8/20 (40%)
leucine-rich repeat 127..148 CDD:275378 7/20 (35%)
leucine-rich repeat 149..162 CDD:275378 4/12 (33%)
LRGUKNP_001352629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..96
LRR 1 129..149
leucine-rich repeat 131..150 CDD:275380
PPP1R42 <132..181 CDD:455733
LRR 2 150..171
leucine-rich repeat 151..172 CDD:275380
LRR 3 172..193
leucine-rich repeat 173..194 CDD:275380
PPP1R42 176..369 CDD:455733 57/172 (33%)
LRR 4 194..215 4/11 (36%)
leucine-rich repeat 195..216 CDD:275380 4/12 (33%)
LRR 5 216..237 11/20 (55%)
leucine-rich repeat 217..238 CDD:275380 11/20 (55%)
LRR 6 238..259 9/21 (43%)
leucine-rich repeat 258..281 CDD:275380 8/23 (35%)
LRR 7 260..280 6/19 (32%)
LRR 8 281..302 6/23 (26%)
leucine-rich repeat 282..300 CDD:275380 5/17 (29%)
LRR 9 303..324 9/23 (39%)
leucine-rich repeat 304..328 CDD:275380 10/26 (38%)
GMPK 416..592 CDD:238026 34/156 (22%)
PHA03247 <784..1126 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.