Sequence 1: | NP_001015502.3 | Gene: | Ppr-Y / 3355180 | FlyBaseID: | FBgn0046697 | Length: | 569 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254924.1 | Gene: | K10D2.8 / 13189483 | WormBaseID: | WBGene00189952 | Length: | 335 | Species: | Caenorhabditis elegans |
Alignment Length: | 329 | Identity: | 90/329 - (27%) |
---|---|---|---|
Similarity: | 146/329 - (44%) | Gaps: | 68/329 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEDDQINNSEVQKPLVDEVIYPDIEPGIINRSLIESSYLKHVHRGEGRRLHQLEPVVLEQILTMR 65
Fly 66 LEFNNILRIDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVL 130
Fly 131 SLFSNK----------------------IEAIENIDMLTMLVIISLGNNLIDTVEG--------- 164
Fly 165 ----------IERFRFMNNLKIINLEGNPIAK------RTNFCLLKYISAILPKL-NYYEYTFIK 212
Fly 213 S-ELRAEACNLY--YREIREIEDKQEKEIQARKFLEREQSEAKRLASSF--VEHLDGHQLFDSLW 272
Fly 273 -RGD 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppr-Y | NP_001015502.3 | leucine-rich repeat | 63..82 | CDD:275378 | 6/18 (33%) |
LRR_8 | 81..137 | CDD:290566 | 30/77 (39%) | ||
LRR_4 | 81..121 | CDD:289563 | 21/39 (54%) | ||
leucine-rich repeat | 83..104 | CDD:275378 | 12/20 (60%) | ||
LRR_4 | 103..143 | CDD:289563 | 20/61 (33%) | ||
leucine-rich repeat | 105..126 | CDD:275378 | 10/20 (50%) | ||
LRR_8 | 126..184 | CDD:290566 | 25/98 (26%) | ||
LRR_4 | 126..166 | CDD:289563 | 18/80 (23%) | ||
leucine-rich repeat | 127..148 | CDD:275378 | 10/42 (24%) | ||
leucine-rich repeat | 149..162 | CDD:275378 | 5/12 (42%) | ||
K10D2.8 | NP_001254924.1 | leucine-rich repeat | 30..50 | CDD:275380 | 7/30 (23%) |
LRR_4 | 49..90 | CDD:289563 | 17/40 (43%) | ||
leucine-rich repeat | 51..72 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 71..127 | CDD:290566 | 29/55 (53%) | ||
LRR_4 | 71..113 | CDD:289563 | 22/41 (54%) | ||
leucine-rich repeat | 73..94 | CDD:275380 | 12/20 (60%) | ||
LRR_4 | 94..134 | CDD:289563 | 18/39 (46%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 10/20 (50%) | ||
LRR_4 | 116..157 | CDD:289563 | 10/40 (25%) | ||
leucine-rich repeat | 117..138 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 139..160 | CDD:275380 | 4/20 (20%) | ||
LRR_4 | 160..199 | CDD:289563 | 9/38 (24%) | ||
leucine-rich repeat | 161..182 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 182..235 | CDD:290566 | 12/52 (23%) | ||
leucine-rich repeat | 183..204 | CDD:275380 | 2/20 (10%) | ||
LRR_4 | 205..245 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 205..226 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 252..273 | CDD:275380 | 3/20 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160158748 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |