| Sequence 1: | NP_001015502.3 | Gene: | Ppr-Y / 3355180 | FlyBaseID: | FBgn0046697 | Length: | 569 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001128689.1 | Gene: | LRRC23 / 10233 | HGNCID: | 19138 | Length: | 343 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 66/259 - (25%) |
|---|---|---|---|
| Similarity: | 111/259 - (42%) | Gaps: | 42/259 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 YPDIEPGIINRSLIESSYLKHV--HRGEGRRLHQLEPVVLEQILTMRLEFNNIL---RIDHLWIL 80
Fly 81 PNLTKLCLNCNKIETIENI--EMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENI 143
Fly 144 DMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCLLKYISAI--------- 199
Fly 200 --------------LPKLNYYEYTFIKSELRAEACNLYYREIREIEDKQEKEIQARKFLEREQS 249 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ppr-Y | NP_001015502.3 | leucine-rich repeat | 63..82 | CDD:275378 | 4/21 (19%) |
| LRR_8 | 81..137 | CDD:290566 | 17/57 (30%) | ||
| LRR_4 | 81..121 | CDD:289563 | 12/41 (29%) | ||
| leucine-rich repeat | 83..104 | CDD:275378 | 7/22 (32%) | ||
| LRR_4 | 103..143 | CDD:289563 | 10/39 (26%) | ||
| leucine-rich repeat | 105..126 | CDD:275378 | 5/20 (25%) | ||
| LRR_8 | 126..184 | CDD:290566 | 20/57 (35%) | ||
| LRR_4 | 126..166 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 127..148 | CDD:275378 | 6/20 (30%) | ||
| leucine-rich repeat | 149..162 | CDD:275378 | 5/12 (42%) | ||
| LRRC23 | NP_001128689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | ||
| LRR 1 | 92..113 | 5/18 (28%) | |||
| leucine-rich repeat | 93..114 | CDD:275380 | 6/19 (32%) | ||
| LRR 2 | 114..134 | 4/19 (21%) | |||
| leucine-rich repeat | 115..135 | CDD:275380 | 4/19 (21%) | ||
| LRR 3 | 135..155 | 4/23 (17%) | |||
| leucine-rich repeat | 136..156 | CDD:275380 | 4/23 (17%) | ||
| LRR 4 | 156..177 | 5/20 (25%) | |||
| leucine-rich repeat | 157..180 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 180..200 | 4/20 (20%) | |||
| leucine-rich repeat | 181..201 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 200..255 | CDD:290566 | 18/56 (32%) | ||
| LRR_4 | 200..241 | CDD:289563 | 13/40 (33%) | ||
| LRR 6 | 201..222 | 5/20 (25%) | |||
| leucine-rich repeat | 202..223 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 223..265 | CDD:289563 | 15/43 (35%) | ||
| LRR 7 | 223..244 | 8/22 (36%) | |||
| leucine-rich repeat | 224..246 | CDD:275380 | 9/23 (39%) | ||
| LRR 8 | 246..267 | 6/20 (30%) | |||
| leucine-rich repeat | 247..271 | CDD:275380 | 7/23 (30%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..343 | 8/28 (29%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165145940 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||