DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PPG1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_014429.3 Gene:PPG1 / 855766 SGDID:S000005315 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:112/300 - (37%)
Similarity:172/300 - (57%) Gaps:13/300 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNY 89
            |..|...|.|..:|.||.:.:|:.:.:..::.:..||.:.||:||||.|:|.:|..||..|.:||
Yeast     9 RLYKAQLLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQIGGPVPDTNY 73

  Fly    90 LFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY--TIKLWR 152
            ||||||||||..|:||:.||:..|::||....||||||||..|.:.||||.||..:|  ..::|:
Yeast    74 LFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNKYGGNSRVWQ 138

  Fly   153 TFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPK--- 214
            ...|.:..:.:..|:|::|||.||||||::..::||..:.|..::|..|.:.||:||||:..   
Yeast   139 YLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVWSDPEENNNP 203

  Fly   215 IMGWSDND--------RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSA 271
            .:...||.        ||...|||..:|.||:..:..:.|.||||:..:||:.:....:.|::||
Yeast   204 TLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNEGYQIYFDGLVTTVWSA 268

  Fly   272 PNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPGLRKIHS 311
            ||||....|..:::.:.......|.|.:.:.:..|.|.:|
Yeast   269 PNYCYRCGNKASILELYSKDQFYFNVFEEAPENKLLKENS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 109/290 (38%)
MPP_PP1_PPKL 13..300 CDD:277359 109/287 (38%)
PPG1NP_014429.3 MPP_PP2A_PP4_PP6 2..299 CDD:277360 109/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.