DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and CMP2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_013655.1 Gene:CMP2 / 854946 SGDID:S000004521 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:93/284 - (32%)
Similarity:150/284 - (52%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLL 110
            |:|..:|.|:.:.||:.:|||||||:.|||:||:.||.|..::|||||||||||..|.|.:..|.
Yeast   124 ELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTSYLFLGDYVDRGSFSFECLIYLY 188

  Fly   111 AYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCH 175
            :.|:.:.::|:|||||||...:...:.|.:|...:|.:.::....:.::.:|::|:::.:..|.|
Yeast   189 SLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKCCESFNNLPLAALMNGQYLCVH 253

  Fly   176 GGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDND------------------ 222
            ||:||:|.::..|..|.|..::|..||:|||||:||..:.....|.|                  
Yeast   254 GGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVLDKDLTEEDIVNSKTMVPHHGK 318

  Fly   223 -------------RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQ------LITI 268
                         ||.|..|.......|:.......|.|||:..:.||..:...:      |:|:
Yeast   319 MAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAHEAQDAGYRMYKNTKTLGFPSLLTL 383

  Fly   269 FSAPNYCGEFDNAGAMMSVDETLM 292
            ||||||...::|..|::..:..:|
Yeast   384 FSAPNYLDTYNNKAAILKYENNVM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 93/284 (33%)
MPP_PP1_PPKL 13..300 CDD:277359 93/284 (33%)
CMP2NP_013655.1 MPP_PP2B 95..423 CDD:277361 93/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.