DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PPH21

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:138/306 - (45%)
Similarity:192/306 - (62%) Gaps:7/306 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TELNNIDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTD 73
            |.:|.:||.|..:     .|...|:|.|:..||..:.:|...:..:..::.||.||||:||||.|
Yeast    65 TNINQLDQWIEHL-----SKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHD 124

  Fly    74 LLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGF 138
            ||.||..||..|.:||||:|||||||..|:||:..|:|.|::||....:|||||||..|.::|||
Yeast   125 LLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGF 189

  Fly   139 YDECKRRY-TIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGL 202
            ||||.|:| :..:|:.|.|.:...|::|:||.||||.||||||.:..::|:.:|.|..:||.:|.
Yeast   190 YDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGP 254

  Fly   203 LCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLIT 267
            :|||||||||.: .||..:.||...|||.|:..:|.|.:...||.||||:|.:||.:..::.::|
Yeast   255 MCDLLWSDPDDR-GGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVT 318

  Fly   268 IFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPGLRKIHSKS 313
            ||||||||....|..|:|.|||.....|....||.:||...:..|:
Yeast   319 IFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSVSRKT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 134/293 (46%)
MPP_PP1_PPKL 13..300 CDD:277359 131/287 (46%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 131/287 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.