DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and TOPP3

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_176587.1 Gene:TOPP3 / 842708 AraportID:AT1G64040 Length:322 Species:Arabidopsis thaliana


Alignment Length:295 Identity:202/295 - (68%)
Similarity:250/295 - (84%) Gaps:3/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDQLILRIIDTRR---LKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLL 75
            :|.:|.|::..:.   .||:.|||.:|:.||:.::::|::||.||||.||:|||||.||||:|||
plant     6 VDDVIKRLLGAKNGKTTKQVQLTEAEIKHLCSTAKQIFLTQPNLLELEAPIKICGDTHGQFSDLL 70

  Fly    76 RLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYD 140
            |||:|||||||:|||||||||||||||:||:||||||||||.|||||||||||.|.|||||||||
plant    71 RLFEYGGYPPAANYLFLGDYVDRGKQSVETICLLLAYKIKYKENFFLLRGNHECASINRIYGFYD 135

  Fly   141 ECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCD 205
            |||:||::::|:.|.||::|:||:|::||||.|.||||||:|.::::|..:.||.|:||.|||||
plant   136 ECKKRYSVRVWKIFTDCFNCLPVAALIDEKILCMHGGLSPELKHLDEIRNIPRPADIPDHGLLCD 200

  Fly   206 LLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFS 270
            |||||||..|.||.:||||||.|||||.|.:|:..|..||||||||||||||||||.|||:||||
plant   201 LLWSDPDKDIEGWGENDRGVSYTFGADKVEEFLQTHDLDLICRAHQVVEDGYEFFANRQLVTIFS 265

  Fly   271 APNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPG 305
            ||||||||||||||||||::|.|||.:||.|:|.|
plant   266 APNYCGEFDNAGAMMSVDDSLTCSFQILKASEKKG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 200/291 (69%)
MPP_PP1_PPKL 13..300 CDD:277359 198/288 (69%)
TOPP3NP_176587.1 MPP_PP1_PPKL 5..294 CDD:277359 197/287 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.