DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and TOPP2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001032103.1 Gene:TOPP2 / 836034 AraportID:AT5G59160 Length:312 Species:Arabidopsis thaliana


Alignment Length:296 Identity:207/296 - (69%)
Similarity:247/296 - (83%) Gaps:5/296 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDQLILRIIDTRR----LKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            :|.:|.|::|.|.    .||..|.|::||.||..|||:|:.||.||||.||:|||||||||::||
plant    14 LDDIIRRLLDYRNPKPGTKQAMLNESEIRQLCIVSREIFLQQPNLLELEAPIKICGDIHGQYSDL 78

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
            ||||:|||:||.:|||||||||||||||:||:||||||||||||||||||||||.|.||||||||
plant    79 LRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 143

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            ||||||::::||:.|.|.::|:||:|::|:||.|.||||||||.|:.||..:.||.||||.||||
plant   144 DECKRRFSVRLWKVFTDSFNCLPVAAVIDDKILCMHGGLSPDLTNVEQIKNIKRPTDVPDSGLLC 208

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            |||||||...:.||..||||||.|||.|.|.:|:.::..||||||||||||||||||.|||:|||
plant   209 DLLWSDPSKDVKGWGMNDRGVSYTFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFFADRQLVTIF 273

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPS-KKP 304
            ||||||||||||||||||||:|||||.:|||: :||
plant   274 SAPNYCGEFDNAGAMMSVDESLMCSFQILKPADRKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 205/293 (70%)
MPP_PP1_PPKL 13..300 CDD:277359 203/289 (70%)
TOPP2NP_001032103.1 MPP_PP1_PPKL 14..304 CDD:277359 203/289 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.