DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and BSL1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_192217.2 Gene:BSL1 / 828097 AraportID:AT4G03080 Length:881 Species:Arabidopsis thaliana


Alignment Length:288 Identity:131/288 - (45%)
Similarity:182/288 - (63%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPAS------NYL 90
            |...::..||..:.::||.:..:|:|.||:|:.||:||||.||:||||..|:|..:      :||
plant   550 LDSYEVGELCYAAEQIFMHEQTVLQLKAPIKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDYL 614

  Fly    91 FLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY----TIKLW 151
            |||||||||:.|:||:.||||.||:||||..|:|||||:|.||.::||..||..|.    .|..|
plant   615 FLGDYVDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALFGFRLECIERMGENDGIWAW 679

  Fly   152 RTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKG--LLCDLLWSDP--D 212
            ..|...::.:|::|:::.||.|.|||:...:..:.||.::.||..: |.|  :|.|||||||  :
plant   680 TRFNQLFNYLPLAALIENKIICMHGGIGRSISTVEQIEKIERPITM-DAGSLVLMDLLWSDPTEN 743

  Fly   213 PKIMGWSDNDRGVS-VTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCG 276
            ..|.|...|.||.. ||||.|.|.:|..|:|..||.|||:.|.||:|.||:.||||:|||.||||
plant   744 DSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCG 808

  Fly   277 EFDNAGAMMSVDETLMCSFYVLKPSKKP 304
            ..:||||::.|...|:....::.|...|
plant   809 TANNAGAILVVGRGLVIVPKLIHPLPPP 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 130/285 (46%)
MPP_PP1_PPKL 13..300 CDD:277359 129/282 (46%)
BSL1NP_192217.2 PLN02193 <21..>211 CDD:177844
KELCH repeat 30..92 CDD:276965
KELCH repeat 99..149 CDD:276965
KELCH repeat 152..201 CDD:276965
KELCH repeat 205..255 CDD:276965
MPP_Bsu1_C 530..832 CDD:277363 129/282 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.