DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and TOPP9

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_187209.1 Gene:TOPP9 / 819724 AraportID:AT3G05580 Length:318 Species:Arabidopsis thaliana


Alignment Length:313 Identity:200/313 - (63%)
Similarity:257/313 - (82%) Gaps:5/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLQMTTLTELNNIDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICG 65
            |...|..:.|:..:|.:|.|:::.:..||:.|:|.:||.||..:|::|:|||.||||.||::|||
plant     1 MMTSMEGMMEMGVLDDIIRRLLEGKGGKQVQLSEVEIRQLCVNARQIFLSQPNLLELHAPIRICG 65

  Fly    66 DIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESA 130
            |||||:.||||||:||||||::|||||||||||||||:||:||||||||:||...||||||||.|
plant    66 DIHGQYQDLLRLFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKIFLLRGNHEDA 130

  Fly   131 GINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPC 195
            .||||||||||||||:.::||:.|.||::|:||:|::||||.|.||||||:|.|:.||.::.||.
plant   131 KINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDEKILCMHGGLSPELENLGQIREIQRPT 195

  Fly   196 DVPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFF 260
            ::||.||||||||||||.|..||:|:|||:|.|||||:|..|:.::..|||||.|||||||||||
plant   196 EIPDNGLLCDLLWSDPDQKNEGWTDSDRGISCTFGADVVADFLDKNDLDLICRGHQVVEDGYEFF 260

  Fly   261 AKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKP----SKKPGLRKI 309
            |||:|:||||||||.||||||||::|||::|:|||.:|||    |..| |:|:
plant   261 AKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKPAPASSTNP-LKKV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 195/296 (66%)
MPP_PP1_PPKL 13..300 CDD:277359 191/286 (67%)
TOPP9NP_187209.1 MPP_PP1_PPKL 13..300 CDD:277359 191/286 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.