DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:290 Identity:185/290 - (63%)
Similarity:224/290 - (77%) Gaps:0/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLF 78
            :|::|..::..:..:::.:.|:||..|..::|:|.||:||||.:.|||.:.||||||:.||||.|
  Fly    17 LDEMIASLLSWKIDRKMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLRYF 81

  Fly    79 DYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECK 143
            :..|:||...||.|||||||||.|:||:.||||||::||.:..|||||||||.|||.||||||||
  Fly    82 ETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDECK 146

  Fly   144 RRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLW 208
            ||:||:|||.|||||.|:||:||::.|||||||||||.|.|:|.|..|.||.:|...||||||||
  Fly   147 RRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDLLW 211

  Fly   209 SDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPN 273
            |||||..:||..|.||||.|||.|||..|:.|..|||||||||||||||||||||||||:|||.|
  Fly   212 SDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSAVN 276

  Fly   274 YCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303
            ||||||||||||.||..|..:..|:||.|:
  Fly   277 YCGEFDNAGAMMCVDAELNITLVVMKPKKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 184/288 (64%)
MPP_PP1_PPKL 13..300 CDD:277359 182/285 (64%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 182/285 (64%)
PP2Ac 36..305 CDD:197547 182/268 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.