DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ppp3cca

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_005171933.1 Gene:ppp3cca / 557926 ZFINID:ZDB-GENE-030829-36 Length:508 Species:Danio rerio


Alignment Length:315 Identity:108/315 - (34%)
Similarity:174/315 - (55%) Gaps:29/315 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QMTTLTEL-----NNIDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKI 63
            |..|:.:|     .|.:.|...:|...|:::    :..:|:: |....:...:..:||:.||:.:
Zfish    26 QRLTIKDLYVDGKPNTELLKNHLIKEGRVEE----DAALRII-NDGANILRQEKCMLEVEAPITV 85

  Fly    64 CGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHE 128
            |||:||||.||::||:.||.|..:.|||||||||||..|||.:..|...||.:|...||||||||
Zfish    86 CGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFSIECVLFLWTLKINHPNTLFLLRGNHE 150

  Fly   129 SAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLAR 193
            ...:...:.|..|||.:|:.:::...::.:.|:|::|:::::..|.||||||::..::.|.:|.|
Zfish   151 CRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDR 215

  Fly   194 PCDVPDKGLLCDLLWSDP------DPKIMGWSDND-RGVSVTFGADIVGKFVHRHKFDLICRAHQ 251
            ..:.|..|.:|||:|:||      :.....::.|. ||.|..|....|..|:..:....:.|||:
Zfish   216 FKEPPAFGPMCDLIWADPGEDYGSEKTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSVIRAHE 280

  Fly   252 VVEDGYEFFAKRQ------LITIFSAPNYCGEFDNAGAMMSVDETLM------CS 294
            ..:.||..:.|.|      ||||||||||...::|..|::..:..:|      ||
Zfish   281 AQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 106/309 (34%)
MPP_PP1_PPKL 13..300 CDD:277359 105/301 (35%)
ppp3ccaXP_005171933.1 MPP_PP2B 39..343 CDD:277361 105/302 (35%)
PP2Ac 59..327 CDD:197547 98/268 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.