DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PPP6C

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:247 Identity:113/247 - (45%)
Similarity:161/247 - (65%) Gaps:2/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIE 104
            ||:...::.:.:..:..:|.||.:||||||||.||..||..||..|.:||:|:||:||||..|:|
Human    64 LCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLE 128

  Fly   105 TMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY-TIKLWRTFVDCYSCMPVSAIVD 168
            |...|||.|.|:|:...||||||||..|.::|||||||:.:| ....||.....:..:.|:|::|
Human   129 TFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALID 193

  Fly   169 EKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADI 233
            |:|.|.|||||||:..::||..:.|..::|.||..|||:||||: .:..|:.:.||....|||.:
Human   194 EQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE-DVDTWAISPRGAGWLFGAKV 257

  Fly   234 VGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMM 285
            ..:|||.:...|||||||:|.:||:|....:|:|::||||||....|..::|
Human   258 TNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 113/247 (46%)
MPP_PP1_PPKL 13..300 CDD:277359 113/247 (46%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 113/247 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.