DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PPEF1

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:336 Identity:98/336 - (29%)
Similarity:154/336 - (45%) Gaps:76/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QLNLTETDIRLLCNRSRE------------VFMSQPMLLEL----------SAPVKICGDIHGQF 71
            |..||.|||.||....:|            :|.::.:|.::          |..|.||||:||:.
Human   113 QFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKL 177

  Fly    72 TDLLRLFDYGGYPPASN-YLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRI 135
            .||..:|...|.|...| |:|.||:|||||.|||.:.:|....:.||.:..|.|||||...:|..
Human   178 DDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLR 242

  Fly   136 YGFYDECKRRYTI---KLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLAR---- 193
            |||..|...:|.:   ::.:...:.|:.:|:..|||.:|...|||:| :..::|.:.::.|    
Human   243 YGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGIS-ETTDLNLLHRVERNKMK 306

  Fly   194 -----PCDV----------------------------PDKGL-------LCDLLWSDPDPKIMGW 218
                 |.:.                            |.:.|       :.|:|||||..|...:
Human   307 SVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCF 371

  Fly   219 SDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGA 283
            .:..||....||.|:..|.:::::..::.|:|:...:|||.....:::|||||.||..|..|.||
Human   372 PNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGA 436

  Fly   284 MMSVDETLMCS 294
            .:.     :||
Human   437 YIK-----LCS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 98/336 (29%)
MPP_PP1_PPKL 13..300 CDD:277359 98/336 (29%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 97/334 (29%)
Catalytic 121..455 93/328 (28%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.