DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ppp5c

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_005157433.1 Gene:ppp5c / 541536 ZFINID:ZDB-GENE-050327-75 Length:489 Species:Danio rerio


Alignment Length:271 Identity:108/271 - (39%)
Similarity:165/271 - (60%) Gaps:12/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 REVFMSQPMLLEL----SAPVKICGDIHGQFTDLLRLFDYGGYP-PASNYLFLGDYVDRGKQSIE 104
            :||....|.|:|:    |..:.||||.|||:.|||.:|:....| |.:.|||.||:||||..|:|
Zfish   207 KEVLTKLPSLVEITLKESEKITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVE 271

  Fly   105 TMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDE 169
            .:..|..:|:.|||:|.|||||||:..:|::|||..|.|.:|:.::::.|.:.:..:|::..:::
Zfish   272 VILTLFGFKLLYPEHFHLLRGNHETDNMNQMYGFEGEVKAKYSSQMFKLFSEVFQWLPLAQCIND 336

  Fly   170 KIFCCHGGL-SPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADI 233
            |:...|||| |.|.:.::.|.::.|....||.|.:||||||||..: .|.|.:.||||..||.|:
Zfish   337 KVLVMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQLQ-NGRSISKRGVSCQFGPDV 400

  Fly   234 VGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSV-DETLMCSFY- 296
            ..:|:.::|.:.|.|:|:|..:|||.....:.||:|||||||.:..|.||.:.: ...|...|: 
Zfish   401 TERFLEQNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQ 465

  Fly   297 ---VLKPSKKP 304
               |..|:.||
Zfish   466 FTAVPHPNVKP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 106/268 (40%)
MPP_PP1_PPKL 13..300 CDD:277359 105/265 (40%)
ppp5cXP_005157433.1 BamD 17..>149 CDD:276939
TPR_11 17..83 CDD:290150
TPR repeat 18..46 CDD:276939
TPR repeat 18..46 CDD:276809
TPR repeat 51..81 CDD:276809
TPR repeat 55..81 CDD:276939
TPR_9 62..124 CDD:290108
TPR repeat 84..116 CDD:276939
TPR repeat 86..114 CDD:276809
MPP_PP5_C 166..481 CDD:277362 108/271 (40%)
PP2Ac 194..470 CDD:197547 104/263 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.