DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PpD6

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster


Alignment Length:299 Identity:175/299 - (58%)
Similarity:239/299 - (79%) Gaps:6/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRR--LKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLL 75
            |::.|:.:::..||  :::|.|.|:::.|||..:||:|:.:||||.:.||:::.|||||||.|||
  Fly    31 NLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLL 95

  Fly    76 RLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYD 140
            ::.|..||||.:.||||||||||||.|:||:.||||.::|:|::.:||||||||..:||:|||:|
  Fly    96 KILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFD 160

  Fly   141 ECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCD 205
            |||||||:|||:||||||:||||:||:..:||||||||||.|..::.|..:|||.:||:.|||||
  Fly   161 ECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCD 225

  Fly   206 LLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFS 270
            |||||||....||:.:|||||..:|.|::.||:.::.|||:|||||||||||||||||||:|:||
  Fly   226 LLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFS 290

  Fly   271 APNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPGLRKI 309
            ||||||.:|||||.|.||:.|:.||.:    ::..:|:|
  Fly   291 APNYCGLYDNAGASMGVDKDLVISFDI----QRGDIRRI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 173/291 (59%)
MPP_PP1_PPKL 13..300 CDD:277359 173/288 (60%)
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 168/265 (63%)
PP2Ac 54..315 CDD:197547 165/260 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.