DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and flw

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster


Alignment Length:276 Identity:212/276 - (76%)
Similarity:248/276 - (89%) Gaps:0/276 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFL 92
            ||:.:||.::|.||.:|||:|:.||:||||.||:.||||||||:|||||||:|||:|||:|||||
  Fly   156 KQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFL 220

  Fly    93 GDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDC 157
            ||||||||||:||:||||||||||||||||||||||.|.|||||||||||||||.:|||:||.||
  Fly   221 GDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDC 285

  Fly   158 YSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDND 222
            ::|:||:||:|||||||||||||||..|.||.:|.||.||||.||||||||||||..:.||.:||
  Fly   286 FNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND 350

  Fly   223 RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSV 287
            ||||.|||.|:|.||::||:.||||||||||||||||||:|||:|:||||||||||||||.||:|
  Fly   351 RGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTV 415

  Fly   288 DETLMCSFYVLKPSKK 303
            |:||||||.:||||:|
  Fly   416 DDTLMCSFQILKPSEK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 211/274 (77%)
MPP_PP1_PPKL 13..300 CDD:277359 208/271 (77%)
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 208/271 (77%)
PP2Ac 160..430 CDD:197547 208/269 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S19
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.