DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and PpD5

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:315 Identity:200/315 - (63%)
Similarity:238/315 - (75%) Gaps:17/315 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLQMTTLT--------ELNNIDQLILRI-------IDTRRLKQLNLTETDIRLLCNRSREVFMS 50
            ||.:.|.|:        |.|.:.||.:.|       :..||..  ||:|..|..:|..|||:|:|
  Fly     1 MSRRSTVLSTGKESSKEEKNRMSQLDVIIGQLKTMAVGNRRAG--NLSEATITYICQASRELFLS 63

  Fly    51 QPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIK 115
            ||||||||||||||||:||||.||||:|...|.||.|||||||||||||..||||:.|||.||::
  Fly    64 QPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLR 128

  Fly   116 YPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSP 180
            |||.|||||||||||.:||:|||:|||||||:|||||:|||||.||||:||:.::|||.||||||
  Fly   129 YPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSP 193

  Fly   181 DLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDL 245
            ||.|::.|.:|.||.|||..||||||||||||.....|:.||||||.||||:||..|:.:|||:|
  Fly   194 DLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNL 258

  Fly   246 ICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKP 300
            |.||||||||||||||.|||:|||||||||..|||.||::.||..|:|.|.:::|
  Fly   259 IVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 196/298 (66%)
MPP_PP1_PPKL 13..300 CDD:277359 193/293 (66%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 195/297 (66%)
MPP_superfamily 25..313 CDD:301300 192/289 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.