DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and ppp2cb

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_998458.1 Gene:ppp2cb / 406582 ZFINID:ZDB-GENE-040426-2487 Length:309 Species:Danio rerio


Alignment Length:284 Identity:135/284 - (47%)
Similarity:187/284 - (65%) Gaps:6/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKQLN----LTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYPPAS 87
            ::|||    |||..:|.||.:::|:...:..:.|:..||.:|||:||||.||:.||..||..|.:
Zfish    14 VEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDT 78

  Fly    88 NYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRY-TIKLW 151
            ||||:|||||||..|:||:.||:|.|::|||...:|||||||..|.::|||||||.|:| ...:|
Zfish    79 NYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVW 143

  Fly   152 RTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIM 216
            :.|.|.:..:|::|:||.:|||.||||||.:..::.|..|.|..:||.:|.:|||||||||.: .
Zfish   144 KYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDR-G 207

  Fly   217 GWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNA 281
            ||..:.||...|||.||...|.|.:...|:.||||:|.:||.:...|.::|||||||||....|.
Zfish   208 GWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQ 272

  Fly   282 GAMMSVDETLMCSFYVLKPSKKPG 305
            .|:|.:|:||..||....|:.:.|
Zfish   273 AAIMELDDTLKYSFLQFDPAPRRG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 134/280 (48%)
MPP_PP1_PPKL 13..300 CDD:277359 133/277 (48%)
ppp2cbNP_998458.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 134/279 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.