DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and rdgC

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:318 Identity:106/318 - (33%)
Similarity:160/318 - (50%) Gaps:33/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NNIDQLILRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQ-----PMLLELSAPVKICGDIHGQF 71
            |:||.|    ||..|.|:.|........|..|.....:.|     |:...:|..|.:|||:||:.
  Fly   188 NHIDLL----IDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKL 248

  Fly    72 TDLLRLFDYGGYPPASN-YLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRI 135
            .|||.:....|.|.:|| |:|.||:|||||:.:|.:.|||:..:.:|...||.|||||.:.:|..
  Fly   249 DDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNAR 313

  Fly   136 YGFYDECKRRY--TIKLWRTFVD-CYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLAR---- 193
            |||..|.:.:|  ..|....|:| .|..:|:.::::.::...|||.| |..:::.|..:.|    
  Fly   314 YGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYV 377

  Fly   194 -----------PCDVPDKGLLCDLLWSDPDPKIMGWSDND-RGVSVTFGADIVGKFVHRHKFDLI 246
                       |.|..:...:.|::||||. ..||...|. ||..|.||.|:...|:.||:...:
  Fly   378 SILRPPLTDGEPLDKTEWQQIFDIMWSDPQ-ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYV 441

  Fly   247 CRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSVDETLMCSF--YVLKPSK 302
            .|:|:...:|:||....::||||||.||.....|.||.:.::..||..|  |:...|:
  Fly   442 IRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQ 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 106/318 (33%)
MPP_PP1_PPKL 13..300 CDD:277359 104/313 (33%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 104/311 (33%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.