DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and CG11597

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:123/305 - (40%)
Similarity:180/305 - (59%) Gaps:15/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LNNIDQLI--LRIIDTRRLKQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTD 73
            :|:.|:|:  ||.:..|..::|     ::|.||....::.:.:..||.|.:|..:||||||||.|
  Fly    10 MNDADRLVENLRHVPVRLPREL-----EVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFED 69

  Fly    74 LLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGF 138
            ||.|.:.||......||||||.|||||.|:||..||.|.|:::|....|||||||.....|.|||
  Fly    70 LLHLLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGF 134

  Fly   139 YDECKRRY-TIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGL 202
            |:||..|| :..:||.....:..:|::||:|..|.|.|||||||:..::.:..|.|..::|:.|:
  Fly   135 YEECLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGI 199

  Fly   203 LCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLIT 267
            :.|||||||. :..||:.:.||....||.|:|.:|...:...|||||||:.:||:.:...:.|:|
  Fly   200 IADLLWSDPQ-EAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVT 263

  Fly   268 IFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKKPGLRKIHSK 312
            |:||||||....|..|::.::......|.|.:      .:.:|||
  Fly   264 IWSAPNYCYRCGNKAAILRLNAAGDYDFKVFE------AQALHSK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 120/294 (41%)
MPP_PP1_PPKL 13..300 CDD:277359 119/289 (41%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 122/303 (40%)
MPP_superfamily 12..296 CDD:301300 119/295 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.