DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:267 Identity:139/267 - (52%)
Similarity:181/267 - (67%) Gaps:6/267 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDLLRLFDYGGYP------PASNYLFL 92
            |.:|..:|.|:||.|..:||.||:.|||.|||||||||.|||.:||..|:|      .:|.||||
 Worm    38 EKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKSSRYLFL 102

  Fly    93 GDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDC 157
            |||:|||..|||.:.||.||::.:|:..|||||||||..:|..||||:||||||::.|:.||...
 Worm   103 GDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRYSVTLYETFQWA 167

  Fly   158 YSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDND 222
            :.|||:.|||..:|.|.|||:...||::.||.:..||.|:.|.|:..||.|:||...::|:.|:.
 Worm   168 FYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWADPVSGVVGFQDSP 232

  Fly   223 RGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMSV 287
            ||....||...|.:|..:.|.|||.||||||.|||||||.::|:||||||.|||.|||.||::.|
 Worm   233 RGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYCGHFDNLGAVLQV 297

  Fly   288 DETLMCS 294
            ...:.|:
 Worm   298 ATNMECT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 139/267 (52%)
MPP_PP1_PPKL 13..300 CDD:277359 139/267 (52%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 139/267 (52%)
MPP_superfamily 36..304 CDD:301300 138/265 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.