DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-Y2 and gsp-2

DIOPT Version :9

Sequence 1:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001022616.1 Gene:gsp-2 / 3564807 WormBaseID:WBGene00001748 Length:333 Species:Caenorhabditis elegans


Alignment Length:294 Identity:217/294 - (73%)
Similarity:259/294 - (88%) Gaps:3/294 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHGQFTDL 74
            |:|.:|.|:::.|..   |.:.|||::|:.||.:|||:|:|||:||||.||:|||||:|||:.||
 Worm     7 NLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDL 71

  Fly    75 LRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINRIYGFY 139
            ||||:|||:||.||||||||||||||||:||:||||||||||||||||||||||.|.||||||||
 Worm    72 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 136

  Fly   140 DECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPDKGLLC 204
            |||||||.||||:||.||::|:||:||:|||||||||||||||.:|.||.::.||.||||:||||
 Worm   137 DECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLC 201

  Fly   205 DLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQLITIF 269
            ||||||||..:.||.:||||||.|||.::|.||:|:|..||||||||||||||||||||||:|:|
 Worm   202 DLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLF 266

  Fly   270 SAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303
            |||||||||||||:||:|||||||||.:|||:.|
 Worm   267 SAPNYCGEFDNAGSMMTVDETLMCSFQILKPADK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 216/292 (74%)
MPP_PP1_PPKL 13..300 CDD:277359 214/289 (74%)
gsp-2NP_001022616.1 PTZ00480 5..315 CDD:185658 217/294 (74%)
MPP_PP1_PPKL 7..297 CDD:277359 214/289 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S19
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.